KEGG   Lactobacillus mucosae: LBLM1_06710
Entry
LBLM1_06710       CDS       T03814                                 

Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
lmu  Lactobacillus mucosae
Pathway
lmu00010  Glycolysis / Gluconeogenesis
lmu00230  Purine metabolism
lmu00620  Pyruvate metabolism
lmu01100  Metabolic pathways
lmu01110  Biosynthesis of secondary metabolites
lmu01120  Microbial metabolism in diverse environments
lmu01200  Carbon metabolism
lmu01230  Biosynthesis of amino acids
lmu01240  Biosynthesis of cofactors
Module
lmu_M00002  Glycolysis, core module involving three-carbon compounds
lmu_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
lmu_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBLM1_06710
   00620 Pyruvate metabolism
    LBLM1_06710
  09104 Nucleotide metabolism
   00230 Purine metabolism
    LBLM1_06710
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lmu04131]
    LBLM1_06710
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lmu04147]
    LBLM1_06710
Enzymes [BR:lmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     LBLM1_06710
Membrane trafficking [BR:lmu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    LBLM1_06710
Exosome [BR:lmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   LBLM1_06710
SSDB
Motif
Pfam: PK PK_C HpcH_HpaI
Other DBs
NCBI-ProteinID: AJT50726
UniProt: A0A0D4CLH4
LinkDB
Position
complement(1449580..1451001)
AA seq 473 aa
MKKTKIVSTLGPASTDVDTIVKLINAGANIFRFNFSHGDHPEHLGRMNNVKKAQEITGKH
VGLMLDTKGAEIRTTVEKDGKIEFNAGDKVRISMDDSIEGTHEKIAVTYPGLYDDVHVGG
HVLFDDGLIDMIIDEKDEANHELVCTVQNHGLLGSRKGVNAPGVSINLPGITEKDSSDIR
FGLEQGINYIAASFVRKPEDIEDIRALLKEKNMEDVQIFPKIESQEGIDNFEAIMAVADG
LMVPRGDMGVEIPAENVPLVQKKMIRRCNEMGKPVITATQMLDSMEENPRPTRAEVSDVA
NAVFDGTDATMLSGESANGDWPVEAVSTMARIDVKAENNLDLFGTETFNFDKSDVTETIG
SAVAQAAKDLDIKVIVAATSSGYTARMISKYRPNADILALTFDERTERGLMVNWGVQPYV
VDKPADTDEMFALAAKKAVELGFAKSGDKIIVVAGVPMGTPGATNLMRVETIK
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgaagaaaaccaagattgtaagtacccttggtcctgcaagtactgatgttgacacgatt
gtaaagctgatcaatgctggtgccaacattttccgtttcaacttctcacacggtgatcac
ccagaacacctgggccggatgaacaatgttaagaaggctcaagaaatcaccggtaagcac
gttggtctgatgttggacactaagggtgctgaaattcgtactactgttgaaaaagacggt
aagatcgaattcaatgctggtgacaaggttcggatctcaatggacgactctattgaaggt
acgcacgaaaagattgctgttacctacccaggtctgtacgacgacgttcacgttggcggc
cacgttctgtttgatgacggtctgatcgacatgatcatcgacgaaaaggacgaagccaac
catgaactggtctgcacggttcaaaaccatggtctgctgggttcacgcaagggtgtcaac
gcacctggcgtttccatcaacctgccaggtatcacggaaaaggactccagcgacattcgc
tttggtctggaacaaggtatcaactacattgccgcttccttcgttcgtaagccagaagat
atcgaagacattcgtgcactgctgaaggaaaagaacatggaagacgttcaaatcttccct
aagatcgaatctcaagaaggtatcgacaacttcgaagcaatcatggcagttgctgatggt
ctgatggttccacgtggtgacatgggtgttgaaatcccagctgaaaacgtgccattggta
caaaagaagatgattcgccgctgcaacgaaatgggcaagccagttatcacggctacccaa
atgctggactccatggaagaaaacccacgtccaacgcgtgccgaagtttctgacgttgcc
aacgctgtctttgatggtactgatgcaacgatgctgtctggtgaaagtgccaacggtgac
tggccagtagaagccgtttctacgatggctcgcatcgatgttaaggctgaaaacaacctg
gacctgttcggtacggaaacgttcaactttgacaagagcgacgttacggaaacgatcggt
tctgcagttgctcaagccgctaaggaccttgacatcaaggttatcgtagccgctacttct
tcaggctatacggcccgcatgatttccaagtaccgtccaaacgccgacattctggctttg
acgtttgatgaacggactgaacgcggtctgatggttaactggggtgttcaaccatacgtt
gttgacaagccagctgacactgatgaaatgtttgctctggctgctaagaaggcagtcgaa
cttggttttgccaagtcgggcgacaagatcatcgtggttgccggtgttcctatgggcacg
ccaggtgcaaccaacctgatgcgggttgaaacgatcaagtag

DBGET integrated database retrieval system