KEGG   Lactobacillus mucosae: LBLM1_09200
Entry
LBLM1_09200       CDS       T03814                                 

Definition
(GenBank) phosphoglucomutase
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Organism
lmu  Lactobacillus mucosae
Pathway
lmu00010  Glycolysis / Gluconeogenesis
lmu00030  Pentose phosphate pathway
lmu00052  Galactose metabolism
lmu00230  Purine metabolism
lmu00500  Starch and sucrose metabolism
lmu00520  Amino sugar and nucleotide sugar metabolism
lmu00521  Streptomycin biosynthesis
lmu01100  Metabolic pathways
lmu01110  Biosynthesis of secondary metabolites
lmu01120  Microbial metabolism in diverse environments
Module
lmu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBLM1_09200
   00030 Pentose phosphate pathway
    LBLM1_09200
   00052 Galactose metabolism
    LBLM1_09200
   00500 Starch and sucrose metabolism
    LBLM1_09200
   00520 Amino sugar and nucleotide sugar metabolism
    LBLM1_09200
  09104 Nucleotide metabolism
   00230 Purine metabolism
    LBLM1_09200
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LBLM1_09200
Enzymes [BR:lmu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     LBLM1_09200
SSDB
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Other DBs
NCBI-ProteinID: AJT51118
UniProt: A0A0D4CLZ7
LinkDB
Position
complement(1966202..1967926)
AA seq 574 aa
MSWKDTYQTWLDRKDLEPSLKRQLAAMKDEKEIEDAFYGPLSFGTAGMRGLMGPGINRMN
VYTVRQATEGLAQFMDTLGDEIKQRGVAISYDSRHNSRLFAHDAARVLGAHNIKVYIYDN
LRPTPELSFAVRYQHTYAGIMITASHNPKEYNGYKIYGEDGGQMPPKESDLMTSYIRKID
DIFDIKLADEQAMLNSGLETIMGEDVDAAYLENAKKVTINHELAKKYGKEMKFVFTPLCG
TGRMLGERALRQAGFTNYEVEPFEGQPNGDFPGLEHPNPEFPEAFVRSEKLGKQVNADIL
IATDPDADRLGCAIRQPDGEYLLLTGNQIASIMLHYILEAHKQAGTLPANAAAVKSIVST
EFATKIAADYGVKMINVLTGFKWIADQIHQYETKHNHTFMFGFEESFGYLIKPFVRDKDA
IQTLTLLAEVAAYYRSRNMTLYDGLQELFQKYGYFQEKTIANTYAGVEGPAKIKNLMKKF
REEAPTHFAGQQVVVTEDFSNNTKTLADGTVEELGIPESNVLRYVLADGTWIAIRPSGTE
PKLKYYIGTSADTLVGAKQKLADFEKALQEFAEA
NT seq 1725 nt   +upstreamnt  +downstreamnt
gtgagttggaaagatacctaccagacttggcttgatcgcaaagacctggaaccaagcttg
aagcgtcaattggcagcaatgaaggacgaaaaagaaatcgaggatgccttttatggtccg
ctttcgttcggtacggcgggcatgcggggattgatgggccctggtatcaatcggatgaac
gtctacacggttcgtcaagctacggaaggcctggctcaattcatggatacgctgggcgat
gaaatcaagcagcgcggggttgctattagctacgattcccgtcataattcacgcttgttt
gcccatgatgctgctcgtgtcttgggagcccacaatatcaaggtctacatctatgacaat
ctgcggccgaccccagagctgtcatttgccgttcgctaccagcatacttatgccggcatt
atgattacggccagccacaaccctaaggaatacaatggttacaagatctatggcgaagat
ggcggtcagatgccacctaaggaatctgatttaatgaccagctacatccgcaagattgat
gatattttcgacatcaagctggcagatgaacaagcaatgctcaacagtggtctggaaacc
atcatgggcgaagatgttgacgctgcctatctggaaaatgccaaaaaggtcacgatcaac
catgagctggctaaaaagtatggcaaggaaatgaagtttgtctttacgccattgtgcggt
acgggacggatgcttggcgaacgggccctgcgtcaagccggctttaccaactatgaggtt
gagccgtttgaaggtcagccaaacggagactttcctggtttggaacatcctaacccagaa
ttccctgaagcattcgttcgttcagaaaaactgggcaagcaggtcaatgccgacattctg
attgccactgatccggatgccgaccggttgggatgcgcaattcggcagccagatggcgaa
tacctgctcttgactggtaatcagattgcttcgatcatgctgcactacattttggaagcg
cacaagcaggctggaacgctgccagctaatgcagctgcggttaagtcaatcgtttcgact
gaatttgccactaagattgctgctgactatggcgttaagatgattaacgttctaactggc
tttaagtggattgccgatcagattcaccaatatgaaaccaagcacaaccacacgtttatg
ttcggttttgaagaaagttttggctacctgatcaagccattcgttcgcgacaaggatgcc
atccaaactctgacgctgctggcagaagtggctgcctactaccggagccgcaacatgacg
ctgtacgacggtctgcaggaattgttccaaaagtacggctacttccaagaaaagacgatt
gccaatacctatgccggtgttgaaggtccagccaagatcaagaatctgatgaagaagttc
cgtgaagaagcgccaacgcattttgctggtcaacaggttgtagtaacggaagacttctcc
aacaataccaagacgctggctgacggtacggttgaagagctgggaattcctgaatcgaac
gtattgcgctacgttttggctgatggtacctggattgccattcgtccttctggtacggaa
ccaaaactcaagtactacattggtacgagtgctgatacgctggtgggcgccaagcagaaa
ctggctgactttgaaaaggcactgcaagaatttgctgaagcctag

DBGET integrated database retrieval system