KEGG   Lactobacillus mucosae: LBLM1_09530
Entry
LBLM1_09530       CDS       T03814                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lmu  Lactobacillus mucosae
Pathway
lmu00010  Glycolysis / Gluconeogenesis
lmu00071  Fatty acid degradation
lmu00350  Tyrosine metabolism
lmu00620  Pyruvate metabolism
lmu00625  Chloroalkane and chloroalkene degradation
lmu00626  Naphthalene degradation
lmu00650  Butanoate metabolism
lmu01100  Metabolic pathways
lmu01110  Biosynthesis of secondary metabolites
lmu01120  Microbial metabolism in diverse environments
lmu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBLM1_09530
   00620 Pyruvate metabolism
    LBLM1_09530
   00650 Butanoate metabolism
    LBLM1_09530
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LBLM1_09530
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    LBLM1_09530
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LBLM1_09530
   00626 Naphthalene degradation
    LBLM1_09530
Enzymes [BR:lmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LBLM1_09530
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     LBLM1_09530
SSDB
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 DUF3196
Other DBs
NCBI-ProteinID: AJT51177
UniProt: A0A0D4CLZ8
LinkDB
Position
complement(2034111..2036750)
AA seq 879 aa
MTVKAKATVKATEKPKDKEQTAEELINGLIDKSEKALDQLRTFSQEQVDKICQNLALAAE
EHHMDLAISAAEETGRGVAEDKAIKNIYASEYIWNNIRNDKTVGIIDEDDENQMITIADP
LGVIAGVVPVTNPTSTVIFKSIIALKTRNTIIFSFHPQAFKSCLKTGQILEAAAEAAGAP
KDVIQWIPQCSRENTTALLQNPRIATILATGGPGLVKAAYSSGNPALGVGPGNGPAYIEK
SANIDRSIYDIVLSKTFDNGMICATENSVVIDDEIYDQVKEAFKKWNCYFLKPSEIPTFT
NGFIDPDRHQVRGPIAGRSANDIAEMCGLKNVPANTKVLIAELDGVGPKYPLSAEKLSPV
LTMYRAKSREDAFRICSELLAYGGEGHTAAIHTNDDELIKEYSLKMKASRIIVNSPSGLG
GIGNVYNNMTPSFTLGTGSYGSNSISHNVSDWDLLNIKKVAMRRDNPQWVQIPPKVYFQR
NSLKYLKEIPNINKAFIVTGPGMVKRGYIQRVIDQLRLRNNRVQYEIFSDIEPDPSTDTV
DKGVAWMNDFQPDTIIALGGGSPMDAAKAMWMFYEHPDTTWNGVRQKYLDIRKRAYKIGR
PKKAQFIGIPTTSGTGSEVTPFAVITNSKTHVKYPLADYALTPDIAIVDSQFVESVPANT
TAWTGLDVLTHATESYVSVMATDYTRGWSLEAIKGVMENLEASVKGDKLARKKMHDSSTI
AGLAFANAFLGITHSLAHKMGGAFDLPHGLVIAIALPQVIRFNAKRPTKLAMWPHYEDYR
ADKDYAAIARFLGLKGDTTEELVEAYVQKIIELAHKCGVTLSLKANGVKREDFDKVVDQL
AVLAYEDQCTTANPVEPLVSQLKELLERCYEGTGVETEE
NT seq 2640 nt   +upstreamnt  +downstreamnt
atgacagttaaagctaaagccactgttaaggccactgaaaagcctaaagacaaggaacaa
accgctgaagaactgattaacggcttgattgataagagtgaaaaagctcttgatcaattg
cgcacatttagccaagaacaggttgacaaaatttgccaaaaccttgcattggccgctgaa
gaacatcatatggatctggctatttcagccgctgaagaaactggtcgtggggtagctgaa
gacaaggctatcaagaacatctacgccagtgaatatatctggaacaacatccgcaatgac
aagacggttggcattatcgatgaagatgatgaaaaccaaatgattacgattgctgatcca
ctgggggtaattgctggggtcgtaccagttaccaacccaacgtcaacggttatcttcaag
tcgatcattgccttaaagacgcggaacacgattatcttctcattccacccacaggccttt
aagtcatgtctgaagactggtcagatcttggaagccgctgctgaagccgctggggcgcca
aaagacgtaattcaatggattccacaatgcagtcgtgaaaatacgacggcactgctgcag
aatcctcgtatcgccacgattttggctactggtggccctggactggttaaggcagcctac
agttctggtaatcctgccttgggtgttggtcctggtaacggtcctgcctacattgaaaag
agtgccaacattgatcgttccatctacgacatcgtattatcaaagacctttgacaatggg
atgatctgtgccactgaaaactcggttgtcattgacgacgaaatctacgaccaggttaaa
gaagcctttaagaagtggaactgctacttcttgaagccaagcgagattccaacgtttacc
aatggctttattgatcctgatcggcaccaggtccgtggcccgattgctggtcgttctgca
aatgatattgctgaaatgtgtgggctgaagaacgttccagctaataccaaagtactgatt
gccgagctggatggggttggccctaagtatccattgtcagccgaaaagctttcgccagta
ctgacaatgtaccgtgccaagagtcgtgaagatgcattccggatctgtagcgaactgctg
gcctacggtggtgaaggtcacacggcagccatccataccaacgatgatgaattgatcaag
gaatactcactgaagatgaaggcttcccgaatcatcgtcaactcgccatcaggtcttggt
ggtattggtaatgtctacaacaacatgacgccatcatttacgctggggacgggttcatac
ggcagcaactcgatctcgcacaacgtttctgactgggatctgctgaacattaagaaggtt
gctatgcgtcgtgataatccacaatgggtacagattccgccaaaggtctacttccagcgg
aactcactgaagtacctgaaagaaattccaaacatcaacaaggcatttatcgttaccggt
ccaggaatggttaagcgcggttatattcagcgggttattgaccagctgcggctgcgcaac
aaccgggttcaatacgagatcttctccgatatcgaacctgacccatcaacggatacggtt
gacaagggtgttgcctggatgaacgacttccagccagacacgatcatcgcgctgggtggt
ggttcgccaatggacgctgctaaggcaatgtggatgttctatgagcacccagacacgact
tggaatggggttcggcaaaagtaccttgatatccgtaagcgggcctacaagatcggccgg
ccaaagaaggcacaatttatcgggatccctacgacttctggtaccggttctgaagttacg
ccatttgcggttatcaccaactccaagacgcatgtcaagtacccactggctgactacgct
ttgacgccggacatcgcaattgtcgactcgcaattcgttgaatccgtgccagccaacacg
acggcctggactggtctggacgtcttgacgcacgctacggaatcatacgtttccgtaatg
gcaactgactacacgcgtggctggtcgctggaagccatcaagggcgttatggaaaatctt
gaggcatccgtcaagggcgacaagctggcccgcaagaagatgcatgacagctccacgatt
gctggtctggcctttgccaatgccttcttggggatcacgcactctttggctcacaagatg
ggtggggcctttgatctgccacacggtctggtaattgcgattgcactgccacaagtaatt
cgtttcaacgctaagcggccaaccaagctggcaatgtggccacattacgaagactaccgt
gctgacaaggactatgcagcgattgcccgtttcttaggcttgaagggcgatacgactgaa
gagctggttgaagcatacgtacaaaagattatcgaattggctcataagtgtggcgtaacg
ctgagcttgaaagctaatggcgttaagcgcgaagactttgacaaggtcgttgatcaactg
gccgttctggcttatgaagaccaatgtacgactgctaacccggttgaaccactggtcagc
cagcttaaggaactgttggaacgctgctacgaaggcactggcgtcgaaactgaagaatag

DBGET integrated database retrieval system