KEGG   Listeria monocytogenes SLCC2755 (serotype 1/2b): LMOSLCC2755_0220Help
Entry
LMOSLCC2755_0220  CDS       T02219                                 

Definition
(GenBank) chaperonin Hsp33 family
  KO
K04083  molecular chaperone Hsp33
Organism
lmw  Listeria monocytogenes SLCC2755 (serotype 1/2b)
Brite
KEGG Orthology (KO) [BR:lmw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:lmw03110]
    LMOSLCC2755_0220
Chaperones and folding catalysts [BR:lmw03110]
 Heat shock proteins
  HSP33
   LMOSLCC2755_0220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: CBY47812
LinkDB All DBs
Position
229417..230301
Genome map
AA seq 294 aa AA seqDB search
MSDYLVKALAYDGMARVYAAVTTETIKEAQRRHDTWSVSSAALGRTMTGTLFLGAMQKED
QKITVKIEGDGPIGPIVADSNAQGQIRGYVTNPHVHFSELNEAGKLDVRRGVGTSGMLSV
VKDLGFGENFTGQTPIVSGEIGEDFTYYLATSEQINSSVGVGVLVNPDDTIEAAGGFMLQ
LLPGATDEIIDEIEKNLTALPTVSRMIEAGETPESILAKLAGGEDKLQILEKIPVSFECN
CSKERFGSAIISLGKEEIRSMIEEDHGAEAECHFCRNTYDFSEEELEKLYEEAK
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgagtgattatttagttaaagcgttagcctacgatggcatggcgcgtgtatatgcagca
gtaacaaccgaaacaatcaaagaagcacaaagaagacatgatacatggtccgtctcatcc
gccgcacttggtagaacgatgacaggaacacttttccttggagcaatgcaaaaagaagac
caaaaaataactgtaaaaatcgaaggcgacggcccaatcggtccaatcgtagctgatagt
aacgcgcaaggtcaaatcagaggatacgtaacaaatccacacgttcacttcagcgaacta
aatgaagctggaaaacttgacgtccgccgcggcgttggaacatccggaatgctttcagtt
gtaaaagatttaggctttggagaaaatttcaccggacaaacgccaattgtttcaggtgaa
attggtgaagattttacgtattacctagcaacatctgaacaaatcaattcctccgttggt
gtaggagtacttgttaacccagatgatacaatcgaagcagctggcggtttcatgttgcaa
ttactccctggtgcgacagatgaaatcattgatgaaatcgaaaaaaatctgacggctcta
ccaacagtttctagaatgattgaagcgggcgaaactcctgaatcgattttagctaaactt
gcaggcggcgaagataaactacaaatcttagaaaaaatccccgtttcctttgaatgtaac
tgctccaaagaacgctttggcagtgcaataatttcacttggaaaagaagaaattcgttcc
atgatagaagaggatcacggcgcagaagcagaatgtcatttttgtcgtaacacttacgat
ttttcagaagaagaattagaaaaactatacgaagaagctaaataa

DBGET integrated database retrieval system