KEGG   Listeria monocytogenes SLCC2755 (serotype 1/2b): LMOSLCC2755_0567Help
Entry
LMOSLCC2755_0567  CDS       T02219                                 

Gene name
hisI
Definition
(GenBank) phosphoribosyl-AMP cyclohydrolase
  KO
K01496  phosphoribosyl-AMP cyclohydrolase [EC:3.5.4.19]
Organism
lmw  Listeria monocytogenes SLCC2755 (serotype 1/2b)
Pathway
lmw00340  Histidine metabolism
lmw01100  Metabolic pathways
lmw01110  Biosynthesis of secondary metabolites
lmw01230  Biosynthesis of amino acids
Module
lmw_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:lmw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    LMOSLCC2755_0567 (hisI)
Enzymes [BR:lmw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     LMOSLCC2755_0567 (hisI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH
Motif
Other DBs
NCBI-ProteinID: CBY48159
LinkDB All DBs
Position
complement(604839..605156)
Genome map
AA seq 105 aa AA seqDB search
MISVDFSKGLVPTIILDDQNGDVLMLAYMNEESYQKTLETGYTWFFSRSRNELWNKGATS
GHTQKVKQIWTDCDNDTLLIRVTQIGPACHTGKKSCFFNLIKEDF
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgatttctgtagatttttctaaaggtcttgtgccaactattatcctagacgatcaaaat
ggcgacgttttaatgctcgcttatatgaacgaagaaagttatcaaaaaacccttgaaact
ggctatacttggtttttttcgcgctccagaaacgaactttggaataaaggcgcgacaagc
ggacatactcaaaaagtaaaacaaatctggaccgattgtgataacgacacattacttata
cgcgtaacccaaatcggtccagcctgccacaccggcaaaaaaagctgctttttcaatctt
ataaaggaggatttttaa

DBGET integrated database retrieval system