KEGG   Listeria monocytogenes SLCC2755 (serotype 1/2b): LMOSLCC2755_0853Help
Entry
LMOSLCC2755_0853  CDS       T02219                                 

Gene name
ddlA
Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lmw  Listeria monocytogenes SLCC2755 (serotype 1/2b)
Pathway
lmw00473  D-Alanine metabolism
lmw00550  Peptidoglycan biosynthesis
lmw01100  Metabolic pathways
lmw01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lmw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LMOSLCC2755_0853 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LMOSLCC2755_0853 (ddlA)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    LMOSLCC2755_0853 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lmw01011]
    LMOSLCC2755_0853 (ddlA)
Enzymes [BR:lmw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     LMOSLCC2755_0853 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:lmw01011]
 Precursor biosynthesis
  Amino acid ligase
   LMOSLCC2755_0853 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST DUF2922
Motif
Other DBs
NCBI-ProteinID: CBY48445
LinkDB All DBs
Position
893455..894567
Genome map
AA seq 370 aa AA seqDB search
MKTKLILLYGGKSAEHEVSLQTAFSVINALDLEKFEAAPIYITNEGEWIQGPLLSGKLDF
VEQLRFSATDTIKLATTESEKSEGEAISPAVLEADGQETVVFPLLHGPNGEDGTVQGLFE
VLNIPYVGNGVLASSAAMDKIVMKKIFADAGIPQVPAVAVRLIDWKNYQAEMVAEMEEVL
TYPVFVKPANLGSSVGISKATNKKELADAMTEAFLYDRRVVVEQGVVAREIEMGVLGNDT
PVCSVPGEILPEGAVATFYDYKAKYQDNNTALIIPTEVDPEILEQMKEYAVQAFLGLDAS
GLVRADFFLTEDNQLFLNEVNTMPGFTPYSMYPLLWQETGLPYGALIERLVDLAKERHAA
KNALKYKLED
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccaaattaattttgttatacggtgggaaatctgctgaacacgaagtttcctta
caaacagcattttcagttatcaatgctttggatttagaaaaattcgaagctgcgccaata
tatattacgaatgaaggtgagtggattcaaggaccacttctttctgggaagttagatttt
gttgaacaattacgtttttcggctacagatacaataaaacttgcaacaactgaatcagaa
aaatcagaaggggaagcgattagcccggccgttttagaagcagacggacaagagacagtc
gtattcccgcttttacatggtccaaacggagaagatggcactgttcaaggattgttcgaa
gtattaaacattccatatgttggtaacggggtcttggcatcttctgctgcaatggacaaa
atcgtgatgaagaaaatctttgcagatgctggaatcccgcaagttccagcagttgctgtt
cgattaattgattggaagaactatcaagcggaaatggttgcggagatggaagaagtactt
acctatccagttttcgtaaaaccagcaaaccttggttcgagtgttggtattagtaaggca
acgaacaaaaaagaattagcggacgcaatgacagaagcatttttatatgaccgtcgtgtg
gttgttgaacaaggtgttgttgcgcgcgaaatcgaaatgggcgtacttggaaatgatacg
ccagtttgctctgttccgggtgaaattttgccagaaggtgcagttgctacgttttacgat
tacaaagcaaaataccaggataataatactgcgttaattattccgactgaagtagatccg
gaaatcttggaacaaatgaaagaatatgcggttcaagcattcctagggcttgatgcaagc
ggactagtgcgagcggactttttcttaacggaagataatcagttattcttaaatgaagtg
aatacaatgcctggtttcacaccgtacagcatgtatcctcttctttggcaggaaacgggc
ttaccgtacggagcgttaattgaacgattagtcgatttagcgaaagaacgccacgcagcc
aaaaatgcacttaaatataaattagaagactaa

DBGET integrated database retrieval system