KEGG   Listeria monocytogenes SLCC2755 (serotype 1/2b): LMOSLCC2755_2437Help
Entry
LMOSLCC2755_2437  CDS       T02219                                 

Gene name
gadB
Definition
(GenBank) glutamate decarboxylase beta
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lmw  Listeria monocytogenes SLCC2755 (serotype 1/2b)
Pathway
lmw00250  Alanine, aspartate and glutamate metabolism
lmw00410  beta-Alanine metabolism
lmw00430  Taurine and hypotaurine metabolism
lmw00650  Butanoate metabolism
lmw01100  Metabolic pathways
lmw01110  Biosynthesis of secondary metabolites
lmw01120  Microbial metabolism in diverse environments
lmw02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lmw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LMOSLCC2755_2437 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LMOSLCC2755_2437 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LMOSLCC2755_2437 (gadB)
   00430 Taurine and hypotaurine metabolism
    LMOSLCC2755_2437 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    LMOSLCC2755_2437 (gadB)
Enzymes [BR:lmw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     LMOSLCC2755_2437 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: CBY50029
LinkDB All DBs
Position
complement(2512542..2513945)
Genome map
AA seq 467 aa AA seqDB search
MLYSEDDKRKQESYRIPLFGSEEESTSIPKYVLKKEPMEPRIAYQLVKDQLMDEGNARQN
LATFCQTYMEKEAEILMAETLEKNAIDKSEYPQTAELENRCVNILADLWNAPKDMSYLGT
STVGSSEACMLGGLAMKFRWRNHAEKRGLDIQAKRPNLIISSGYQVCWEKFCVYWDVDMR
VVPMDKEHLSIDVDKVFDLVDEYTIGIVGILGITYTGKFDDIQLLDEKVEAYNEANEHQL
VIHVDGASGAMFTPFVNPELPWDFRLKNVVSINTSGHKYGLVYPGVGWILWKDKEYLPKE
LIFEVSYLGGSMPTMAINFSRSASQIIGQYYNFLRYGFEGYREIHEKTKKTALYLAKSVE
KSGYFEIINDGANLPIVCYKMKEGLDVEWTLYDLADQLLMKGWQVPAYPLPADLSDTIIQ
RFVCRADLGYNVAEEFAVDFADALHNLEHARVLYHDKERNDSYGFTH
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgctttatagtgaagacgacaagcgaaaacaggaaagttatcgaatcccactctttgga
tctgaggaagaaagcacgagtatcccgaaatatgtattaaaaaaggaaccgatggaacca
cgtattgcgtaccaactagtgaaagaccagttgatggatgagggaaatgcgcggcaaaac
ttagcaactttttgtcagacatacatggaaaaagaggcagaaatactgatggcagaaacg
ctcgagaaaaatgcaattgataaatccgaatatccgcaaacagctgaactggaaaatcgc
tgcgtcaatattttagccgatttgtggaatgctccaaaagatatgtcttacttggggact
tcgacagtaggctcttcggaagcgtgtatgcttggcggtttggcaatgaaatttcgctgg
cgtaaccatgcggaaaaacgaggtctagatattcaagcgaaacgaccgaacttaattatt
tcatcaggctaccaagtatgttgggaaaaattctgtgtgtactgggatgtagatatgcgt
gttgtgccaatggataaagagcatctcagtatcgatgtagataaagtgtttgatttggtt
gatgaatacacaattgggattgtcgggattttaggcattacttatactggtaaatttgat
gatattcaattattagatgaaaaagtagaagcatataatgaagcgaacgagcatcaatta
gtcattcatgttgacggagcaagtggcgcgatgtttacaccatttgtaaatccggaatta
ccttgggatttccgccttaaaaatgttgtttctataaatacttccggtcataaatacgga
ttggtttatcctggcgttggttggattttatggaaagacaaagaatatttaccaaaagag
cttatatttgaagtcagctacttaggtggttcgatgccgacgatggcgattaacttctct
cgtagtgccagtcaaattattggtcaatattataattttttacgatatggttttgaaggt
taccgagaaattcatgaaaaaacaaagaaaacagccctttacttggcaaaaagtgtagaa
aaaagtggttactttgaaattattaatgatggcgctaatttaccgattgtttgttacaaa
atgaaagaaggactggatgtagagtggacgctatatgacttggctgatcagcttttaatg
aaaggatggcaagttccagcctatccacttccggccgatttaagtgatacgattattcaa
cggtttgtttgtcgggcggacttaggctataacgtggctgaagagtttgcggttgatttt
gcagacgcgcttcataatctggaacatgctagagtgctgtatcatgacaaagaacgcaac
gactcatacggatttacgcactaa

DBGET integrated database retrieval system