KEGG   Listeria monocytogenes SLCC2372 (serotype 1/2c): LMOSLCC2372_0655Help
Entry
LMOSLCC2372_0655  CDS       T02220                                 

Definition
(GenBank) amino acid permease family protein
  KO
K03294  basic amino acid/polyamine antiporter, APA family
Organism
lmx  Listeria monocytogenes SLCC2372 (serotype 1/2c)
Brite
KEGG Orthology (KO) [BR:lmx00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    LMOSLCC2372_0655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C Spore_permease
Motif
Other DBs
NCBI-ProteinID: CBY53990
LinkDB All DBs
Position
685861..687252
Genome map
AA seq 463 aa AA seqDB search
MNSLFRRKPIEDLMHNKSGSTHLKQTLGPLDLTLLGVGAIVGTGIFILPGTVAAKNAGPA
IIFSFVIAAIVCAIAAMCYSEFASSVPVAGSAYTYGYVVFGELIGWLLGWALILEYGLAV
ASVASGWSSYLNALLSGFHISIPEAISGPFNPEVGTFINLPAIIIVLVIAFLLTLGIKES
TRVNTIMVVIKVGVILLFLVVGVFYVKPDNWQPFMPFGISGVMNGAALVFFAYLGFDAVS
SAAEEVKDPQRTMPIGIIGSLLICTVLYVAVSAVLTGMVPYTDLNVTDPVAYALQVINQD
WVAGIVSLGAVVGMITVILVMSYGATRLIFAMGRDGLLPKVLAEINQKYQTPVKNTWIFA
VIVAIISGLVPLDRLAELVNIGTLLAFMMVSIGIIFLRKNKDIQARGFKVPLYPVLPIVS
FLLCAFLISRLSVHTWILCGIWFVIGLIVYFAYGRKHSELLKK
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaattcattatttagaagaaaaccgatagaagatttaatgcataataaaagtggtagc
acgcatttaaagcaaactctcggaccacttgatttaactttacttggggtcggagcaatt
gttggaacagggatttttattttaccagggacagtagctgcgaaaaatgcgggaccggcg
attattttttccttcgtgattgcagcgattgtttgtgcgattgcagcaatgtgctactca
gagtttgcatctagtgttccggttgcagggagcgcctatacgtatggttatgtggttttt
ggtgagttaattggatggttgcttggttgggcacttattttggaatacgggcttgcagtg
gcttctgtggcaagtggatggtcttcttatttaaatgcgttactttcaggttttcatatt
tccatcccggaagcaatctctgggccttttaatccagaagtaggtacatttattaattta
ccggcgattattattgttcttgtgattgcctttttattaacgcttgggataaaagaatca
acgcgcgtgaataccattatggtagtaattaaagtcggtgttattttacttttcttagta
gttggcgtattttatgtcaaaccggataattggcaaccgtttatgccgtttggaattagt
ggagttatgaatggcgcggcgctagttttctttgcttatttaggttttgatgccgtttcc
tccgcggcggaagaagtgaaagatccgcaacggacgatgccgattggaattattgggtcg
ctacttatttgtacggtgttatatgttgctgtatccgctgttttaactggaatggtgccg
tacacagatttaaacgtaactgatcctgtggcttatgccttgcaagtgattaaccaagat
tgggtagctggcattgtatcacttggcgcagttgttgggatgattacggttattttagtg
atgagctacggggctactagactgatttttgcaatgggacgtgatggtttattgccgaaa
gtacttgcggaaatcaatcaaaaataccaaacacctgttaaaaatacttggattttcgca
gtgattgttgcaattattagtgggcttgtgccattggatcgattggctgagttggttaat
attggaacactcttggcgtttatgatggtgtctatcgggattatctttttacgtaaaaat
aaagatattcaagcgagaggatttaaagtaccactttacccagtacttcctattgtttcg
ttcctattatgtgcgtttttaattagccgtttgtctgttcatacgtggattctttgcgga
atttggtttgttattggtttaattgtttactttgcttatggtagaaaacatagtgaatta
cttaaaaaataa

DBGET integrated database retrieval system