KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_0197Help
Entry
LM5923_0197       CDS       T01164                                 

Definition
(GenBank) hypothetical protein
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
Pathway
lmy00040  Pentose and glucuronate interconversions
lmy00051  Fructose and mannose metabolism
lmy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LM5923_0197
   00051 Fructose and mannose metabolism
    LM5923_0197
Enzymes [BR:lmy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     LM5923_0197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 2-Hacid_dh_C FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ADB70043
LinkDB All DBs
Position
204270..205301
Genome map
AA seq 343 aa AA seqDB search
MKAVVKTNPGYDQMELKDVEEPQVYGDKVKIKVAFTGICGSDIHTFKGEYKNPTTPVTLG
HEFSGVVVEVGPDVTSIKVGDRVTSETTFETCGECIYCKEHDYNLCSNRRGIGTQANGSF
AEFVLSREESCHVLDERISLEAAALTEPLACCVHSALEKTTIRPDDTVLVFGPGPIGLLL
AQVVKAQGATVIMAGITKDSDRLRLAKELGMDRIVDTLKEDLAEVVLGMTGGYGAERVFD
CSGAVPAVNQGLPLTKKKGDFVQVGLFAEKKNAIDEESIIQREIAYIGSRSQKPSSWILA
LDLLANGKIDTDKMITKVYGLDDWREAFEAVMAGNEIKVLVKS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagcagtagtaaaaacaaatcccggatatgatcaaatggagctaaaagatgtggaa
gaaccacaagtctatggcgacaaagtaaaaatcaaagtagcattcactggtatttgcgga
tcagatatccatacgtttaaaggagaatacaaaaatccaacaactcccgtcacacttgga
catgaattttctggtgtcgttgtagaagttgggccagatgtaacgagtatcaaagtggga
gaccgtgtcacaagtgaaacaacttttgaaacttgtggagagtgtatttattgtaaggaa
catgattacaatttatgtagcaatcgtcgcggcattggtacgcaagcaaatggtagtttt
gcagaatttgttttatctcgcgaggaaagttgccatgtgctagatgaacgtatttcgctc
gaagcagcagcactgacagaaccacttgcatgttgcgtgcattcggcgcttgaaaaaaca
acgattcgtccagatgacacagtacttgttttcggaccggggccaattggattattacta
gctcaagttgtgaaagcgcaaggggcaacggtgattatggcaggaattaccaaagatagc
gaccgcttacgtctagcaaaagaacttggaatggaccggattgtcgataccttaaaagaa
gacttggctgaagttgtgctcggcatgacagggggttacggagcggaacgcgtatttgat
tgctcaggcgcagtaccagctgtaaatcaaggattacctctaacgaagaaaaaaggcgat
tttgttcaagtaggactttttgccgaaaagaaaaatgcgattgatgaagaatctattatc
caacgtgaaattgcttatattggcagccgttctcaaaaaccatcttcttggattttagca
ctcgacttacttgctaatggcaaaatcgatacagataaaatgattaccaaagtatatggt
ttagatgactggcgcgaggctttcgaggcagttatggcaggaaatgaaattaaagtatta
gtgaaatcttaa

DBGET integrated database retrieval system