KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_0356Help
Entry
LM5923_0356       CDS       T01164                                 

Definition
(GenBank) hypothetical protein
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
Pathway
lmy00010  Glycolysis / Gluconeogenesis
lmy00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lmy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LM5923_0356
   00500 Starch and sucrose metabolism
    LM5923_0356
Enzymes [BR:lmy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LM5923_0356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase Glyco_hydro_10
Motif
Other DBs
NCBI-ProteinID: ADB70202
LinkDB All DBs
Position
complement(362870..364285)
Genome map
AA seq 471 aa AA seqDB search
MHTNTGFPADFLWGGAAAANQFEGAYNVDGKGLSVQDVTPKGGFGHITDGPTPDNLKLEG
IDFYHRYKDDVKLFAEMGFKVFRTSIAWSRIFPNGDETEPNEAGLQFYDDLFDELLAHNI
EPLITLSHYETPLHLSKTYDGWVNRKMIDFYENYVRTVFNRYKGKVKYWLTFNEINSILH
APFMSGGISTSPDKLSQKDLYQAVHHELVASALATKIGHEIMPEAQIGCMVLAMPTYPLT
SHPDDIIAVMEAERKNYFFSDVHVRGTYPGYMKRYFRENNIELDVTEEDLEILKNTVDFI
SFSYYMSTTETADESKRKAGAGNILGGVQNPYLEASEWGWQIDPQGLRVVLNEFWDRYQK
PLFIVENGLGAIDQLEKDENGNYTVNDDYRINYLSAHLSQVKEAIKDGVDLMGYTSWGCI
DLVSASTAEMKKRYGFIYVDRNNDGTGTLNRYKKKSFDWYKNVIATNGEDL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcatacaaatacaggatttccggccgactttttatggggtggagctgctgctgcaaac
caattcgaaggcgcttacaacgtcgatggaaaaggactttccgttcaagatgttactcca
aaaggcggattcggtcacattactgacggtccaacaccagataacttaaaattagaagga
atcgacttctatcatcgctacaaagatgacgtgaaactttttgccgaaatgggcttcaag
gttttccgtacttccatcgcttggtcccgtatcttcccaaatggtgacgaaactgagcca
aacgaagcaggacttcaattttacgatgatttattcgatgaacttctagcacataatatc
gaaccactgattactttatctcactatgaaacaccacttcacttatcgaaaacttacgac
ggctgggtaaatagaaaaatgatcgacttctatgaaaactatgtccgcaccgtatttaat
cgctataaaggcaaagtaaaatattggctaacattcaatgaaatcaactcgattttacat
gcaccattcatgagcggtggtatttctacaagcccagataaattatctcaaaaagaccta
taccaagctgtccaccacgaacttgtggcaagcgcactggcaacaaaaatcggtcacgaa
atcatgccagaagctcaaatcggctgcatggttctagcaatgccaacctatccgctaact
tcccatcccgatgatattatcgctgttatggaagcagagcgcaaaaactacttcttctcc
gatgtccatgtccgcggaacttatccgggctacatgaaacgctatttcagagaaaataat
attgaattagacgtaacagaagaagacctagaaatacttaaaaacacagtagatttcatt
tccttcagctattacatgagcacaaccgaaacagctgacgagtcgaaacgcaaagctggc
gcaggaaacatcctaggcggcgtacaaaacccttacctagaagcatccgaatggggctgg
caaatcgatcctcaaggcttacgcgttgtcctaaacgaattctgggatagataccaaaaa
ccacttttcatcgtagaaaacggtcttggcgctatcgatcaactagaaaaagacgaaaac
ggcaactacacagtaaatgacgactatcgtattaattatttgagcgctcatttatcgcaa
gtgaaagaagcgattaaagatggcgttgacttgatgggttacacttcatggggctgtatt
gaccttgtaagtgcctccactgctgaaatgaagaaacgttacggctttatctatgttgat
cgcaacaacgacggcacaggtacgctaaaccgttataagaagaaaagttttgattggtac
aaaaacgttattgctaccaatggtgaagatttataa

DBGET integrated database retrieval system