KEGG   Listeria monocytogenes serotype 7 SLCC2482: LMOSLCC2482_0451Help
Entry
LMOSLCC2482_0451  CDS       T02221                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lmz  Listeria monocytogenes serotype 7 SLCC2482
Pathway
lmz00250  Alanine, aspartate and glutamate metabolism
lmz00410  beta-Alanine metabolism
lmz00430  Taurine and hypotaurine metabolism
lmz00650  Butanoate metabolism
lmz01100  Metabolic pathways
lmz01110  Biosynthesis of secondary metabolites
lmz01120  Microbial metabolism in diverse environments
lmz02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lmz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LMOSLCC2482_0451
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LMOSLCC2482_0451
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LMOSLCC2482_0451
   00430 Taurine and hypotaurine metabolism
    LMOSLCC2482_0451
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    LMOSLCC2482_0451
Enzymes [BR:lmz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     LMOSLCC2482_0451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: CBY02972
LinkDB All DBs
Position
480877..482265
Genome map
AA seq 462 aa AA seqDB search
MFKTNVEQNNVPVFGSFESGQDLPEKRMNKESVDPRIAYQLVKDQLIDEGSARQNLATFC
QTYMEPEAEQIMAETMEKNAIDKSEYPQTAKLESSCVNMLADLWNVDESEHYMGTSTVGS
SEACMLGGMAMKFRWRSAALKNGLDIHAKKPNLVISSGYQVCWEKFCVYWDIELREVPMS
EEHLSINTDIIMDYVDEYTIGIVGILGITYTGKFDDIMTLNDLVEDYNNTHDNEVVIHVD
GASGAMFTPFVEPGLEWDFRLPNVVSINTSGHKYGLVYPGVGWILWRDKEYLPEELVFDV
SYLGGHMPTMAINFSRSASQIIGQYYNFLRFGYEGYRQIHMRTRDGALQLSQAVAETGLF
EIYNDGANLPIVCYKLKDDANVAWTLYDLADRLQMKGWQVPAYPLPKEMGNTIIQRYVCR
GDLGQNMVTAFKNDLSESIEELNNAHILYHDVNTSKTHGFTH
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaacaaatgttgaacaaaataatgtaccggtgtttggctcttttgagtcagga
caagatttaccagaaaaacgcatgaataaggaatctgtagatccaagaattgcttatcaa
cttgtgaaggatcaactgattgatgagggttcagcgagacaaaatctagctacgttctgt
caaacatatatggaaccggaagctgagcaaatcatggcagaaacgatggagaaaaatgct
attgataaatcagaatatccacagacagcaaagcttgagtctagttgtgtgaatatgttg
gcggatctttggaatgtagatgaatcggagcattacatgggaacgtcgacggttggttct
agtgaggcgtgtatgcttggtggaatggctatgaaatttagatggaggagtgctgcactc
aaaaatggattagacatccacgctaaaaaaccaaacttggttatttcttcaggctatcaa
gtttgttgggaaaagttctgtgtatactgggatattgagttacgtgaagtaccgatgagt
gaggagcatttgagtatcaatacagatatcataatggactatgtagatgaatatacaatt
ggtattgtgggtattctgggcatcacctatacagggaaattcgacgatatcatgacttta
aatgaccttgtggaagactataataatacacatgacaatgaagttgtaattcatgttgac
ggtgcgagtggtgcaatgtttacaccgtttgttgagccgggtttagaatgggattttcga
ttaccaaatgttgtttcgattaatacatcagggcacaaatatggtcttgtatacccaggt
gtaggctggattttatggcgggacaaggaatatttgccagaagaattagtgtttgatgtg
agctatcttggtgggcatatgcctacgatggccatcaatttttccagaagtgcgagtcag
attatcggtcagtattataatttcttacgcttcggatatgagggttatcgtcaaattcat
atgcgtacaagagatggtgccttgcaattatcacaagctgttgcagaaacaggacttttc
gaaatttataacgatggcgcaaacttaccaatcgtatgttacaaactaaaagacgatgct
aatgtggcgtggacgctttatgacttggcagatcgcttacaaatgaaaggttggcaagta
ccggcgtatccacttccaaaagaaatgggtaacacaattattcaacgttatgtttgtcgc
ggcgatttaggacaaaatatggttacagctttcaaaaacgatttgagtgaaagtattgaa
gaactaaataacgctcatattttatatcatgatgtcaatacatctaaaacacatggcttt
actcattaa

DBGET integrated database retrieval system