KEGG   Listeria monocytogenes serotype 7 SLCC2482: LMOSLCC2482_0502Help
Entry
LMOSLCC2482_0502  CDS       T02221                                 

Definition
(GenBank) alcohol dehydrogenase, zinc-dependent
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
lmz  Listeria monocytogenes serotype 7 SLCC2482
Pathway
lmz00040  Pentose and glucuronate interconversions
lmz00051  Fructose and mannose metabolism
lmz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LMOSLCC2482_0502
   00051 Fructose and mannose metabolism
    LMOSLCC2482_0502
Enzymes [BR:lmz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     LMOSLCC2482_0502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C PALP 2-Hacid_dh_C PrmA TrkA_N Pyr_redox_2 HAD UDPG_MGDP_dh_N Methyltransf_25 ELFV_dehydrog Pyr_redox Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: CBY03023
LinkDB All DBs
Position
536796..537842
Genome map
AA seq 348 aa AA seqDB search
MKALKLYGKRDLRYEEADMPTIEQPDDVILKVKTVGICGSDISRYSKLGPYVPGMVWGHE
FSGEVIEVGSEVTDIEIGDRAAGCPALYCGECEYCKKGEFARCRKLTVIGARHPGAYAEY
IKLPAENVVKIPDELDYEAAALVEPSAVVVHGFYHTKLQAGDDVVVVGSGNIGLLAIQWA
KVFGAKRVIAIDVDDKKLALAKEVGADVVINSLKEDPLEVVAAHTDGLNADLVVEAAGSP
ITSAQVFAYAKKGGGVVFLGIPYADVTIERFYFEKIVRSELTVWGSWNAISAPFPGKEWQ
TTIHFLANKQINIEPMITHRLSLAEGPEVFERIYERNEFFGKVLFFPE
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctttaaaattatatggaaaaagagatttgcgttatgaagaagcggatatgcca
acaatcgaacagccagatgatgtgattttgaaagtgaaaacggttgggatttgcggatct
gatatttcgagatacagtaaacttggtccgtatgtaccaggaatggtgtggggacatgaa
ttttcaggagaagtgattgaggttggtagtgaggttacagatattgagattggtgatagg
gctgccggatgcccagcactctattgcggagagtgtgaatactgtaaaaaaggcgaattc
gcccgctgtcggaagctaacagtaatcggagcaagacatcccggagcctatgctgagtat
atcaaacttccagcagaaaatgtagtaaaaataccagacgaattagattatgaagctgct
gcacttgtcgagccttccgcagtggtcgttcatgggttttatcatacgaaattacaagca
ggcgatgatgtcgtcgttgtcggaagcggcaatataggtttgctagcaattcaatgggca
aaagtttttggcgcaaaaagagttattgcaattgatgtagacgataaaaagttagctctt
gcaaaagaagtaggagcagacgtcgttattaattctttaaaagaagatccattagaagta
gtcgcagcacatacagatggtctaaacgctgatttagttgtagaagctgcgggatcacct
attacatctgcccaagtttttgcctatgcgaaaaaaggtggaggcgtcgttttcctaggg
attccatacgccgatgtaacaatcgaacgtttctattttgaaaaaattgtgcgtagtgag
cttactgtttggggctcatggaatgcaatttctgcaccatttccaggaaaagaatggcaa
acaaccattcacttcctagccaataaacaaatcaacattgaaccaatgattacacatcgt
ctttcacttgctgaaggaccagaagtttttgagcgaatctatgaaagaaatgaatttttc
gggaaagtattatttttcccagaataa

DBGET integrated database retrieval system