KEGG   Labrys neptuniae: FZC33_02995
Entry
FZC33_02995       CDS       T06193                                 

Gene name
tssK
Definition
(GenBank) type VI secretion system baseplate subunit TssK
  KO
K11893  type VI secretion system protein ImpJ
Organism
lne  Labrys neptuniae
Brite
KEGG Orthology (KO) [BR:lne00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lne02044]
    FZC33_02995 (tssK)
Secretion system [BR:lne02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   FZC33_02995 (tssK)
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: QEN85231
UniProt: A0A5C1W917
LinkDB
Position
2:671676..673010
AA seq 444 aa
MSWYSKVAWSEGLFLRPHHLQQGDRYLEHLLEGRTGQITPYPWGFSEIEIDRDLAQQSKF
GLRRAAGVLSDGTPFRFPGDCPPPPPATVPENAAGLFVWLCMPMAQPNNREVDELESESG
SRYVVQSETLIDASSALQIEEEIDIAVPRFSYEIRRTPKPGFVSMLCARIIEVNDKTIVF
DERFAPPVLVVAAHAAVTGWLDRVIGWVETKLDELARFASDPRSSGGMQSVDYFVLQMLN
REIPALRHMRRSKYTHPERLYVELLRLAGELATYSTRERRANDYPAYDHDNPGATFAPVL
ADIQRFLSVDISRAIRLEIVEKATNAFLATVTDRNLFRASTFVLEVAAQRSLTELQTQFP
ALFKVGPNTRMNEIVHAHLPGIGLIHLPTPPAQIRAITSHVYFALDRMSPLWPEFSTASG
IGMHFSGDWPGLELNLWVVKEDVK
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgtcctggtatagcaaagtcgcttggtcggaaggtctgttcctccggccgcatcacttg
cagcagggcgatcgttatctcgaacatctgctcgagggccgcaccggccagatcacgccc
tatccctggggcttcagcgaaatcgagatcgatcgcgacctggcccagcaaagcaagttc
ggcttgcgccgcgccgccggcgtcctgtcggacggcacgccgtttcgcttccccggtgat
tgcccgccgccgccgcccgccacggtacctgaaaatgccgccgggctgttcgtctggctg
tgcatgcccatggcccagcccaacaaccgcgaggtcgatgagctggagagcgaaagcggc
agccgctatgtggtgcaatcggagaccctgatcgatgcttcctccgccttgcagatcgag
gaggagatcgacatcgcggtaccgcgcttcagctacgagatccgccggacgccgaaaccg
ggcttcgtttccatgctctgtgcccggatcatcgaagtcaacgacaagaccatcgtcttc
gacgagcgctttgccccgcccgtgctggtggtcgccgcccatgctgccgttaccggctgg
ctcgaccgtgtgatcggctgggtggagaccaagctcgatgaactggcgcgctttgcttcg
gacccgcgctccagcggcggcatgcagagcgtcgactattttgtgctgcagatgctcaac
cgcgaaattccggcgcttcggcacatgcgccgttcgaaatacacccatcctgagcggctc
tatgtggagttgctgcgtctggccggggagctggcgacctattccacgcgggagcggcgc
gccaacgactatccggcctatgaccatgacaatcccggcgccaccttcgccccggtactg
gccgacattcagcgcttcctcagcgtcgacatcagccgcgccatccggctcgaaatcgtg
gagaaggccaccaatgccttcctggcgaccgtgaccgatcgcaacctgttccgggcctcg
accttcgtgctggaagtggcggcgcagcgctcgctcaccgagttgcagacgcagttcccg
gctctgttcaaggtcggccccaatacgcgtatgaacgagatcgtgcacgcccatcttccc
ggcatcgggctcattcacctgccgacgccgccggcacagatccgggcgatcaccagccat
gtctatttcgccctcgaccgcatgtcgccgctttggcctgagttcagcaccgcgagcggc
atcggcatgcatttctccggcgactggcccggacttgagctcaatctgtgggtcgtcaag
gaagacgtgaaatag

DBGET integrated database retrieval system