KEGG   Liquorilactobacillus nagelii: BSQ50_09955
Entry
BSQ50_09955       CDS       T06235                                 

Definition
(GenBank) PTS mannose/fructose/sorbose transporter subunit IIC
  KO
K11196  fructose PTS system EIIC component
Organism
lng  Liquorilactobacillus nagelii
Pathway
lng00051  Fructose and mannose metabolism
lng02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:lng00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BSQ50_09955
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BSQ50_09955
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lng02000]
    BSQ50_09955
Transporters [BR:lng02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    BSQ50_09955
SSDB
Motif
Pfam: EII-Sor
Other DBs
NCBI-ProteinID: AUJ32829
UniProt: A0A3Q8CVC0
LinkDB
Position
complement(2061664..2062470)
AA seq 268 aa
MNTGQMLLILLIAGIAGVGSVLDEGQMHRPLIVCPLIGLVLGDLKMGIILGGQLEMMALG
WMNVGLAMAPDTALSAVISTIVVITTHASIGDGIALAVPLAAAGQMLTIFVRTIVVFLVH
QGDKFAKKGKYRAIEAMHLFAMAIQALRVMIPTAGVMILNTKIVEAWLNAIPKVISDGLQ
IGGGIIVVVGYAMVINMMDVPDLKPFFYLGFLFAAFTNFNLVGFGGLGLIFAILYLQLEY
RQPKKTLSTEKIRTTDTKADDNDDELDD
NT seq 807 nt   +upstreamnt  +downstreamnt
atgaataccggtcaaatgctattaatattattgattgcgggaatagccggtgtcggttcg
gtgcttgatgaaggacaaatgcatcggccgctaattgtctgtccgctaattggattggtt
ctaggtgatttaaaaatgggcattatccttggcggacagctcgaaatgatggcattaggc
tggatgaatgtcggtttggcaatggcgccagatacagccctttctgcagtcatttcaaca
attgttgttattacaactcatgcatcaatcggagatggtattgccttggcagtaccctta
gctgctgctggtcaaatgctgacgatttttgtgcggacaattgttgttttcttagttcat
caaggtgataaattcgccaaaaaaggaaagtatcgggcaattgaagcaatgcatctgttt
gcgatggctatccaggccttgcgcgtaatgattccaacagcaggagttatgattttgaat
acaaaaattgttgaagcttggttgaatgcaattcccaaagttattagtgacggtttacaa
attggtggtggaattattgttgtggttggttatgcaatggtaattaatatgatggacgtt
cctgacttgaagccatttttttatttaggattcttatttgctgcctttactaactttaac
ttggttggttttggtgggttagggttaatttttgcaattttatatttgcaactggaatat
cggcaacctaaaaaaaccctttcaactgaaaaaataagaacgactgatactaaggctgat
gataacgatgatgaattggatgattaa

DBGET integrated database retrieval system