KEGG   Liquorilactobacillus nagelii: BSQ50_09965
Entry
BSQ50_09965       CDS       T06235                                 

Definition
(GenBank) hypothetical protein
  KO
K11194  fructose PTS system EIIA component [EC:2.7.1.202]
Organism
lng  Liquorilactobacillus nagelii
Pathway
lng00051  Fructose and mannose metabolism
lng02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:lng00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BSQ50_09965
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BSQ50_09965
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lng02000]
    BSQ50_09965
Enzymes [BR:lng01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.202  protein-Npi-phosphohistidine---D-fructose phosphotransferase
     BSQ50_09965
Transporters [BR:lng02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    BSQ50_09965
SSDB
Motif
Pfam: EIIA-man HTH_24
Other DBs
NCBI-ProteinID: AUJ32831
UniProt: A0A3Q8CDI5
LinkDB
Position
complement(2062980..2063429)
AA seq 149 aa
MVAIIVAGHGRIAAGMVEAAKMIFGGKPSLEAITFENKEGIEDLKRHYQSALVKFMPEKE
ILFLIDIFGGSPYNAAIQLAYGKKGIEVLTGVNLPLLLEALSLQNQPGITVKQLAEHLKK
YSQQSFKIFSEEVRKTEISRQNQVEDDLS
NT seq 450 nt   +upstreamnt  +downstreamnt
atggttgcaatcattgttgctggtcatgggcgaatcgctgctggaatggtagaagcagca
aaaatgatatttggtgggaaaccgagtttagaagcaataacttttgaaaataaggaagga
atcgaagatttaaaacggcattatcaatcagctttggttaaatttatgccagaaaaagaa
attttgtttttgattgatatttttggcggtagtccatataatgcggcaattcaactggca
tatggtaaaaaaggaattgaggtcttaaccggagttaatttaccattattgctggaggct
ttgagtttgcaaaatcaacccggaataactgttaaacaattagctgagcatttaaaaaag
tatagtcagcaaagttttaaaattttttcggaggaagttagaaaaacggaaattagccgt
caaaatcaagtagaggatgatttatcatga

DBGET integrated database retrieval system