KEGG   Lelliottia nimipressuralis: CWR52_01950Help
Entry
CWR52_01950       CDS       T05333                                 

Definition
(GenBank) Zn-dependent oxidoreductase
  KO
K08322  L-gulonate 5-dehydrogenase [EC:1.1.1.380]
Organism
lni  Lelliottia nimipressuralis
Pathway
lni00040  Pentose and glucuronate interconversions
lni01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CWR52_01950
Enzymes [BR:lni01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.380  L-gulonate 5-dehydrogenase
     CWR52_01950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N Shikimate_DH NTP_transf_3 NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: AVH16020
UniProt: A0A2L2J807
LinkDB All DBs
Position
complement(419742..420761)
Genome map
AA seq 339 aa AA seqDB search
MKSVVIQQPNELVIEERPRPVPGAGEVRVKITLAGICGSDSHIYRGHNPFAKYPRTIGHE
FFGVIDAVGEGVDSARLGQRVAVDPVISCGHCYPCSVGKPNVCTSLVVLGVHRDGGFSEY
AAVPAQNAWVIPDDIPDRHAVMVEPFTIAANVTGQAKPMEQDVALIYGAGPMGLVTVQAL
KGVYQVKQVIVVDRIDERLAMARRSGADWVFNNGEQSLQAALEEKGIKPTLIIDAACHPS
ILQEAITLASPAARIVLMGFSSEPSQIVQQGITGKELAIFSSRLNANKFPVVIDWLKRGL
IDPEKLITHTFDYHHVTDAIELFEKDQRQCCKVLLTFGQ
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcgtagtgattcaacagccgaacgaactggtgattgaagagcggccacgcccg
gtgccaggcgcaggtgaagtccgcgtgaaaatcaccctggcgggtatctgcgggtcggac
agccacatctatcgcggccataatccttttgcgaaatatccacgcacgattggccacgag
ttttttggcgtgattgacgccgtgggtgagggcgtagacagtgcccgtctgggccagcgc
gtcgcggttgacccggtgatcagctgcgggcactgctacccgtgctccgtgggaaaaccg
aacgtctgtacctcgctggtcgtgctgggggtccaccgtgacggcggcttcagtgaatat
gcggcagtgcccgctcaaaatgcctgggtcattccggatgacattcccgaccgacacgcc
gtcatggttgaacccttcaccattgccgccaacgtaacggggcaggcgaaaccgatggaa
caggacgtcgcgctgatatacggcgctggcccgatgggactggtcaccgtgcaggcgctg
aaaggcgtctatcaggtgaagcaggttatcgtggttgaccgcatagacgagcgcctggcg
atggcgcggcgcagcggcgcggattgggtctttaataacggcgagcagtcgctgcaggcc
gcgctggaggaaaaaggcatcaaaccgacgctaatcattgatgccgcctgccatccatct
attttgcaggaagcgataaccctggcctcgccagcggcgcgcatcgtgctgatgggcttt
tccagcgagccgagccagattgttcagcagggcattaccggcaaagagctggcgatcttc
tcctcgcgcctgaatgccaacaaattcccggtcgtcatcgactggctgaagagggggctg
atcgacccggaaaaactgatcacccatacttttgactatcaccacgtaacagacgccatc
gaactgtttgagaaagatcagcggcagtgctgcaaagtcttactcacgttcggccaataa

DBGET integrated database retrieval system