KEGG   Lelliottia nimipressuralis: CWR52_06290Help
Entry
CWR52_06290       CDS       T05333                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
lni  Lelliottia nimipressuralis
Brite
KEGG Orthology (KO) [BR:lni00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CWR52_06290 (ahpF)
Enzymes [BR:lni01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CWR52_06290 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored NAD_binding_8 HI0933_like Thi4 FAD_binding_3 K_oxygenase Glutaredoxin FMO-like DAO AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AVH16826
UniProt: A0A2L2JAL8
LinkDB All DBs
Position
complement(1288767..1290332)
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSPKVTFKEDNSLNV
RKPSFLITNPGSELGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQALLEQIRDIDGDFE
FETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGTFQNEITDRNVMGVPAVYLNGQE
FGQGRMTLTEIVAKVDTGAEKRAAEALNKRAAYDVLIVGSGPAGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSDYDVDVIDSQSASKLVPAAVEG
GLHQIETASGAVLKARSIIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIILNAQTTEVKGD
GSKVTGLEYRDRVSGDVHSVQLSGIFVQIGLLPNTTWLEGAIERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacactaatatgaaaacccagctcaaggcctatcttgagaaactgactaaaccc
gttgagctgattgccacgctggacgacagcgcgaaatcggcagagatcaaggaactgctg
gctgagatcgccgaactgtcgccaaaagtgaccttcaaagaagataactcgcttaacgtc
cgtaagccttctttcctgatcactaacccaggctctgagctggggccgcgttttgccggc
tcaccgctggggcatgaatttacctcgctggtgctggcgctgctgtggaccggcggtcat
ccgtcgaaagaggcgcaggcgctgctggagcagatccgcgatatcgacggtgattttgag
tttgaaacctattactcgctctcctgccataactgcccggacgtggtgcaggcgctgaac
ctgatgtcggtcctcaacccgcgcatcaagcacacggcaattgacggcggtaccttccag
aatgaaatcaccgatcgcaacgtgatgggcgttccggcggtgtatctgaacggtcaggaa
ttcggtcagggtcgtatgacgctgacggaaatcgttgccaaagtggataccggtgccgaa
aaacgtgccgcagaagcgctgaacaaacgtgctgcctatgacgtgttgattgtcggttcc
ggtccggcgggcgcggcggcggcagtgtactccgcgcgtaaagggatccgcacgggcctg
atgggcgagcgcttcgggggccaggtactggataccgtggacattgaaaactatatctcc
gtgccgaaaaccgaaggccagaaactggccggcgcgctgaaggcgcacgtcagcgattac
gacgtagacgtgatcgacagccagagcgccagcaagctggtacctgctgcggttgagggg
gggttacaccagattgaaaccgcctccggcgcagtgctgaaagcacgcagcatcatcatt
gccaccggggcgaaatggcgcaacatgaacgtcccgggtgaagatcagtatcgcaccaaa
ggcgtgacctactgcccgcactgcgacggcccgctgttcaaaggcaagcgagtggcggtg
atcggcggcggaaactccggcgtggaagcggctatcgacctggcggggattgttgaacac
gtcacccttctggagttcgcgccagaaatgaaagccgaccaggtgctgcaggacaaagtt
cgcagcctgaaaaacgtcgacatcatactgaacgcgcagaccacggaagtgaagggcgac
ggcagcaaggtgaccggtctggaataccgcgaccgcgtgagtggcgacgtgcacagcgtg
cagctttcagggatcttcgtgcagattggtctgctgccaaacaccacctggctggaaggc
gcgattgagcgcaaccgcatgggcgaaatcattattgatgcgaagtgtgaaaccagcgtg
aagggcgtgtttgcggcgggcgactgcaccaccgtgccgtataaacagatcattatcgcc
acgggtgaaggggcgaaggcgtctctgagcgcgtttgactacctgatccgcactaaaact
gcataa

DBGET integrated database retrieval system