KEGG   Lelliottia nimipressuralis: CWR52_07525Help
Entry
CWR52_07525       CDS       T05333                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
lni  Lelliottia nimipressuralis
Pathway
lni00730  Thiamine metabolism
lni00790  Folate biosynthesis
lni01100  Metabolic pathways
lni02020  Two-component system
Module
lni_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:lni00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    CWR52_07525
   00790 Folate biosynthesis
    CWR52_07525
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CWR52_07525
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lni04147]
    CWR52_07525
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lni00537]
    CWR52_07525
Enzymes [BR:lni01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CWR52_07525
Exosome [BR:lni04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CWR52_07525
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lni00537]
 Enzymes
  CWR52_07525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Phosphodiest Sulfatase
Motif
Other DBs
NCBI-ProteinID: AVH17057
UniProt: A0A2L2JB48
LinkDB All DBs
Position
complement(1545318..1546733)
Genome map
AA seq 471 aa AA seqDB search
MKQSALFIALLPLLITPAIYADTTQTSVLDNRAAKGDITQPGGARRLSEDQTAAIRASLN
EKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYALDKKTGKPDY
VTDSAASATAWSTGVKTYNGALGVDIHEHDHQTLLEMAKAAGLATGNVSTAELQDATPAA
LVAHVTSRKCYGPSVTSEKCPTNALEKGGKGSITEQLLNARPDVTLGGGAKTFAETATAG
EWQGKTLREQAQARGYQLVSDANALAAISEANQDKPLLGLFSDGNMPVRWEGPKASYHGN
IDKPAVTCTPNPKRTDSVPTLAAMTDKAISLLSKGEKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQKALAFAKKDGNTLVIVTADHAHASQIIPPDTKAPGLTQALNTKDGAVM
VMSYGNSEEESMEHTGTQLRIAAYGPHAANVVGLTDQTDLFYTMKAALGLK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacagagcgcacttttcattgcattacttcccctgttaattacccctgccatttat
gcagatacgacacaaaccagcgtgctggataatcgtgcggcaaaaggggatatcacccag
cctggcggcgcgcgccgtttatcagaagatcaaactgctgctattcgcgcttcgctgaat
gagaagccggcaaaaaatattattctgctgattggcgatggaatgggcgattccgaaatc
acggcggcgcgaaattatgccgagggagcgggcggcttttttaaaggtatcgacgcctta
ccgctaaccggacaatatacccactacgcgctggataaaaaaaccggtaaaccggattac
gtaacggattccgcggcctctgccacggcgtggtccaccggcgtgaaaacctataatggt
gcgctgggcgtggatattcacgaacacgatcatcaaacccttctggagatggcaaaagcg
gcgggcctggcgaccggcaacgtctctaccgctgaacttcaggatgcgacgcctgcggcg
ctggtggcacacgtgacctcgcgtaagtgctacggcccgtcagtgaccagcgaaaaatgc
ccaacaaatgcgctggaaaaaggcgggaaaggctcgattacggaacaactgctgaacgca
cgtcctgacgtgacgctgggcggcggcgcgaaaaccttcgcggaaaccgcgacggcgggc
gaatggcagggcaaaacgctgcgcgagcaggcgcaggctcgcggctatcagctggtgagt
gacgcaaatgctctggcggcgataagcgaggcgaaccaggacaagccgctgctggggctg
ttctccgacggtaacatgcccgtgcgctgggaaggtccaaaagcctcgtatcacggcaat
atcgataagcctgcggtgacctgtacgccaaacccgaaacgcacggacagcgtaccgacg
ctggcggcgatgaccgataaagcgatctctctgctgagcaagggcgaaaaagggttcttc
ctgcaggtagaaggcgcgtcaatcgataagcaggatcatgcggcgaatccgtgcggtcag
attggcgaaaccgtcgatctggacgaagcggtgcagaaagcgctcgcgttcgcgaaaaaa
gacggtaacaccctggtgatcgtcaccgcggaccacgcgcacgccagccagatcattccg
ccagataccaaagcccctggcctgacgcaggcgctgaacaccaaagatggtgccgtcatg
gtgatgagctacggtaactctgaagaagagtccatggagcacacgggcacccagctgcgc
attgccgcttacggcccgcacgcggcaaacgtggtaggcctgacggatcaaacggatctg
ttctacaccatgaaggcggcactgggtctgaaatga

DBGET integrated database retrieval system