KEGG   Lelliottia nimipressuralis: CWR52_11165Help
Entry
CWR52_11165       CDS       T05333                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
lni  Lelliottia nimipressuralis
Pathway
lni00250  Alanine, aspartate and glutamate metabolism
lni00410  beta-Alanine metabolism
lni00640  Propanoate metabolism
lni00650  Butanoate metabolism
lni01100  Metabolic pathways
lni01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CWR52_11165
   00650 Butanoate metabolism
    CWR52_11165
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CWR52_11165
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CWR52_11165
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lni01007]
    CWR52_11165
Enzymes [BR:lni01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CWR52_11165
Amino acid related enzymes [BR:lni01007]
 Aminotransferase (transaminase)
  Class III
   CWR52_11165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AVH17717
UniProt: A0A2L2JD07
LinkDB All DBs
Position
complement(2310583..2311848)
Genome map
AA seq 421 aa AA seqDB search
MKNNELNDRRLQATPRGIGVMCNFYADKAENATVWDVEGNEYIDFAAGIAVLNTGHRHPK
VIAAIEKQLHAFTHTAYQIVPYEGYVALAERINQRVPIDGPAKTAFFSTGAEAVENAVKI
ARAYTKRPGLITFGGAFHGRTFMTMALTGKVAPYKLGFGPFPGSVYHAQYPNELHGVSTA
EALKSLERIFKADIAPDQVAAIILEPVQGEGGFNIAPADFMQALRALCDTHGILLIADEV
QSGFARTGKLFSMEHHCVKPDLITMAKSLAGGMPLSAVSGRAEAMDAPAPGGLGGTYAGN
PLAIAAAHAVLDVIDEEDLCTRSAHLGHHLVEVLNKAKEHCPYIADIRAQGSMVAVEFND
PQTGQPSPEFTRQVQERALQEGLLLLSCGVYGNVIRFLYPLTIPEVQFRKALDIISASLT
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaacaacgaactgaacgaccggcgtttacaggcgacgccgcgtggcatcggcgtg
atgtgtaacttctatgccgataaagcagaaaacgccacggtgtgggacgtcgagggcaat
gagtacatcgacttcgccgccggtatcgcggtgctaaataccggccatcgccatccaaaa
gtcattgccgccatcgaaaaacaactccacgcgtttacccatacggcgtaccagattgtg
ccgtacgagggctatgtcgcgcttgccgaacgcatcaaccagcgcgtgccgattgacggt
cccgccaagaccgccttcttctcgacgggcgcagaagcggtggaaaacgcggtcaaaatt
gcccgcgcatataccaaacgccccggccttatcacctttggcggcgccttccatggccgc
acctttatgaccatggcgctgaccggcaaagttgcgccgtacaagctcggctttggacct
ttccccggttcggtttatcacgcgcagtatccgaatgaactgcacggcgtcagcaccgct
gaggcgttgaaaagcctggaacgcatctttaaagcggatatcgcacccgaccaggtcgcg
gcgattattctcgaaccggttcagggagagggcggtttcaacatcgcgccagccgatttt
atgcaggcgctacgtgccctgtgcgatacccacggcattttgctcattgccgacgaggtg
caaagcggcttcgcccgcaccggcaagctgttctcaatggaacaccactgcgtgaaaccg
gatctgatcaccatggcgaaaagcctggcgggcgggatgccgctctcggcggtgtcggga
cgtgctgaggcgatggatgcgcccgcgccgggcgggctgggtggcacctacgccggaaac
ccgctggcgattgccgcggcgcatgccgtgctggacgtgattgacgaagaggatctctgc
acgcgatcggcgcatctgggccatcacctggtggaagtgctgaacaaagcgaaggaacac
tgcccgtatatcgcggatattcgcgcccagggctcaatggtggcggtggagtttaacgac
ccgcaaacgggccagccttcgccggaatttacccgccaggtgcaggagcgggcgttgcag
gaagggctgcttcttctgagctgcggcgtctacggcaacgtcattcgtttcctgtatccg
ctgacgattcccgaagtgcagttccgtaaagcgctggacattatctccgcctcgctgaca
cgttaa

DBGET integrated database retrieval system