KEGG   Lelliottia nimipressuralis: CWR52_13690Help
Entry
CWR52_13690       CDS       T05333                                 

Gene name
fadB
Definition
(GenBank) fatty acid oxidation complex subunit alpha FadB
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
lni  Lelliottia nimipressuralis
Pathway
lni00071  Fatty acid degradation
lni00280  Valine, leucine and isoleucine degradation
lni00281  Geraniol degradation
lni00310  Lysine degradation
lni00362  Benzoate degradation
lni00380  Tryptophan metabolism
lni00410  beta-Alanine metabolism
lni00640  Propanoate metabolism
lni00650  Butanoate metabolism
lni00903  Limonene and pinene degradation
lni00930  Caprolactam degradation
lni01100  Metabolic pathways
lni01110  Biosynthesis of secondary metabolites
lni01120  Microbial metabolism in diverse environments
lni01130  Biosynthesis of antibiotics
lni01200  Carbon metabolism
lni01212  Fatty acid metabolism
Module
lni_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:lni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CWR52_13690 (fadB)
   00650 Butanoate metabolism
    CWR52_13690 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CWR52_13690 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CWR52_13690 (fadB)
   00310 Lysine degradation
    CWR52_13690 (fadB)
   00380 Tryptophan metabolism
    CWR52_13690 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CWR52_13690 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CWR52_13690 (fadB)
   00281 Geraniol degradation
    CWR52_13690 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CWR52_13690 (fadB)
   00930 Caprolactam degradation
    CWR52_13690 (fadB)
Enzymes [BR:lni01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     CWR52_13690 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CWR52_13690 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     CWR52_13690 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     CWR52_13690 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AVH18172
UniProt: A0A2L2JE93
LinkDB All DBs
Position
complement(2830204..2832393)
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYLNWLEDGIAELVFDAPGSVNKLDTATVASLGQALDVLEKQPELKGLLLRSN
KAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTISAVNGYALGGGCEC
VLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGAEQAQK
IGLVDGVVKPEKLVEGALAILRQAIKGELDWKAKRQPKLEPLKLSKIEATMSFTIAKGMV
MQTAGKHYPAPITAVKTIEAAARLGRDEALKLENQSFVPLAHTNEARALVGIFLNDQFVK
GKAKQLTKNVETPKHAAVLGAGIMGGGIAYQSAWKGVPVVMKDINEKSLTLGMTEAAKLL
NKQLERGKIDGLKLAGVISTIQPVLEYSGFDRVDVVVEAVVENPKVKKAVLAETEDKVRP
DTVLASNTSTIPISELASVLKRPENFCGMHFFNPVHRMPLVEVIRGEKTSDDTIAKVVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSKGKP
KKEEDAAVDSLLADVSQPKRDFTDDEIIARMMIPMINEVVRCLEEGIIASPAEADMALVY
GLGFPPFHGGAFRWLDTLGSARYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPAVEPA
RPVGELKTA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctctacaaaggcgacaccctgtacctcaactggctggaagatggcattgcagaactg
gtgttcgatgcccccggctcagtgaacaagcttgataccgcgacggtggccagtcttggc
caggcgctggatgttcttgaaaaacaacctgaattaaaagggctgctgctgcgttcgaac
aaagcggcctttatcgtcggtgctgatatcaccgagttcctttcgctgttcctggtcccg
gaagaacagctgagccagtggctgcactttgccaacagcgtctttaatcgtctggaagat
ctgcctgtcccgactatttccgccgttaacggctatgcgctgggcggtggctgcgagtgc
gtgctggcgaccgactatcgcctggcgacgccggacctgcgcatcggcctgccggaaacc
aagctgggcattatgccgggctttggcggctccgtccgtatgccgcgcatgctcggtgcc
gacagcgcgctggagatcattgccgcgggtaaagatgtcggcgcagaacaggcgcagaaa
attggcctggtcgacggcgttgtaaaacctgagaagcttgttgaaggcgcactcgccatt
ctgcgtcaggcgataaaaggcgaactcgactggaaagccaaacgccagccgaagctggaa
ccgttaaaactcagcaagattgaagccaccatgagcttcaccatcgccaaaggcatggtg
atgcagacggcgggtaaacactacccggcaccaatcacggcggtgaaaaccattgaagcg
gctgcccgtctcggacgcgatgaagcgctgaagctcgaaaaccagagctttgtcccgctg
gcgcacaccaatgaagcgcgcgcgctggtcggtatcttcctgaacgatcagttcgtgaaa
ggcaaagccaaacagctgaccaaaaacgttgagacgccaaaacatgcggcggtactcggc
gcgggcattatgggtggcggcatcgcttaccagtcagcctggaaaggcgtgccggtggtg
atgaaagacatcaacgagaaatccctgacgttgggcatgaccgaagcggccaagctgctg
aataaacagctggaacgcggcaaaattgacgggctgaagctcgcaggcgtgatctccacc
attcagcccgtgctggaatacagcggttttgatcgtgtcgacgtggtggtcgaagccgtc
gtcgagaacccgaaggttaaaaaagcggtgctggcggaaacggaagacaaggttcgcccg
gataccgtgctggcctctaacacctccaccattccaatcagcgaactggcgagcgtgctg
aagcgtccggaaaacttctgcggtatgcacttcttcaacccggtacaccgtatgccgctg
gtcgaagtgatccgtggggaaaaaacctctgacgacaccatcgccaaagtggtggcctgg
gccagcaagatgggcaaaacgccgatcgtcgttaacgattgtccgggcttcttcgtcaac
cgcgtgctgttcccttatttcgccggttttagccagctgctgcgcgacggcgcggacttc
cgcaaaatcgacaaagtgatggaaaaacagttcggctggccgatgggaccggcgtatctg
ctggacgttgtgggcattgataccgcccaccacgcccaggcggtaatggcggcaggcttc
ccgcagcgcatgcagaaagactatcgcgacgccattgacgcgctgttcgacgctaaccgc
ttcggccagaaaaacggcctgggcttctggcgctataaagaagacagcaagggcaaaccg
aagaaagaagaagacgcggcggtggatagcctgctggccgatgtcagtcagccgaaacgc
gacttcaccgacgatgagatcatcgcccgtatgatgattccgatgatcaacgaagtggtg
cgttgcctcgaagaaggcattatcgccagcccggcagaagccgacatggcgctggtgtat
ggcctcggcttccctccgttccacggcggcgcgttccgctggctggacacactcggcagc
gcccgctatctcgatatggctcagcagtatcagcacctcggcccgctgtatgaagtgccg
gaagggctgcgtaacaaagcgcgccataacgaaccctactatcccgcagttgagccagcc
cgtccggttggcgagctgaaaacggcttaa

DBGET integrated database retrieval system