KEGG   Lelliottia nimipressuralis: CWR52_15430Help
Entry
CWR52_15430       CDS       T05333                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
lni  Lelliottia nimipressuralis
Pathway
lni00052  Galactose metabolism
lni01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CWR52_15430
Enzymes [BR:lni01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     CWR52_15430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 TrkA_N Methyltransf_31 2-Hacid_dh_C MTS UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AVH18488
UniProt: A0A2L2JFP9
LinkDB All DBs
Position
complement(3176510..3177553)
Genome map
AA seq 347 aa AA seqDB search
MKSVVIHAEGNVRVEERPIPHIQAADDVRVRIACSGLCGSDIPRIFAGGAHYYPITLGHE
FSGHVEACGAEVHDLKAGDPVACVPLLPCFSCPACEKGYYSLCKQYQFVGSRSEGGNAEY
IVVKRANLFRLPAEMAIEDGAFIEPITVGLHAFHLASGCEGKNVIIVGAGTIGLLAMQCA
LALGANSATAVDINDDKLALATALGATQVFNSRSLAAEDIFNALSDNPFDQLVLETAGTP
QTVTLAIDISGPRAQVALVGTLHHDLNLPAATFGKILRKELTLLGSWMNYSAPWPGEEWE
TAARLLTEKKLQLKPLIAHTGNCDSFAQAVQGLNGAPMQGKIMLRFA
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcagtggtaattcacgctgagggcaacgtgcgcgttgaagaacgtccaatccct
cacattcaggctgcggatgatgtgcgggtgcgcattgcctgctcaggactatgtggctcc
gatatcccgcgaatttttgccggaggggcacattattatcccatcaccctgggacatgaa
tttagcggtcatgtcgaagcctgtggtgccgaagtgcacgacctcaaggcaggcgatccg
gttgcctgcgtgccattactgccctgcttctcctgtccggcgtgcgaaaaaggctactac
tcgctctgcaagcagtatcagtttgtcggctctcgtagcgaaggcggtaacgcggaatat
atcgtggtgaagcgcgcaaacctgttccgccttcctgcagagatggcaattgaagatggc
gcatttattgagcccataaccgtagggctacacgcgtttcatctcgcttccggctgcgag
ggcaagaacgtcatcattgtaggcgcaggaacgatcggcctgctggcgatgcagtgtgcg
ctggcattaggcgccaacagtgctaccgctgttgacatcaacgacgataagctcgcgctg
gcaacagcgctgggggcaactcaggtgtttaatagccgctctctggccgcagaggacatc
ttcaacgccttgagcgacaacccgtttgatcagttggttcttgagactgctggcacaccg
caaaccgttacgctcgccattgatatctcagggccgcgcgcccaggtcgctctggtgggt
acgctgcatcacgacctgaacttacctgcggcgacatttggcaagatactgcgtaaggag
ttgacgcttctgggaagctggatgaattattcggccccgtggccgggtgaagaatgggaa
accgcggcgcgccttctcacagagaaaaaactacagctaaagccccttattgctcatacc
ggcaattgcgatagctttgctcaggccgtgcaaggactcaacggtgcgccaatgcagggc
aaaatcatgctgcgcttcgcgtag

DBGET integrated database retrieval system