KEGG   Loa loa (eye worm): LOAG_01166
Entry
LOAG_01166        CDS       T02664                                 

Definition
(RefSeq) autophagy protein Apg6 containing protein
  KO
K08334  beclin
Organism
loa  Loa loa (eye worm)
Pathway
loa04136  Autophagy - other
loa04137  Mitophagy - animal
loa04140  Autophagy - animal
loa04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:loa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    LOAG_01166
   04136 Autophagy - other
    LOAG_01166
   04137 Mitophagy - animal
    LOAG_01166
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    LOAG_01166
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:loa04131]
    LOAG_01166
   03029 Mitochondrial biogenesis [BR:loa03029]
    LOAG_01166
Membrane trafficking [BR:loa04131]
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    LOAG_01166
Mitochondrial biogenesis [BR:loa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    LOAG_01166
SSDB
Motif
Pfam: APG6 APG6_N FapA OmpH
Other DBs
NCBI-GeneID: 9938540
NCBI-ProteinID: XP_003136754
UniProt: A0A1I7VZ18
LinkDB
AA seq 383 aa
MDDNVPTCFNCQNKLVLDESVFECFGDQQNSFLIEEDPSFCFQEGSSAATGNLFDIICSS
NSALKGPMCEDCTGQLLSGMDQHLKELDEECAQYRELLDSLKEGRDARLMDRNIVAAKLT
AMKNEEASLLVESKKLEAEEAKLDAELKKKKSELYAENESAELLWRVFRDNHRQLIRMEM
KEQDLEAEVHCLKSQRDRLSKINVLNTAFHIWKQGSFGTINGFRLGQLPHSQVEWSEINA
AWGQVALLINTLADCLEVQFSLYRIVPVGSHSFIQCLDTGVELPLFGSGGFKPFGQKKFD
EGICAFMECFCQLQRHIERAQFRFPHRMYREHIEDNKMEYSVKMQFNAEERWTKAMKCLL
INFRWAISYVVHSKILRTEAVFS
NT seq 1152 nt   +upstreamnt  +downstreamnt
atggatgacaacgtcccaacatgcttcaattgtcagaataagttggttttggatgagagc
gttttcgagtgctttggagaccaacaaaattcgtttttaattgaggaagatccatcattt
tgcttccaagaaggttcttcagcagcgacagggaatctgtttgatataatatgcagttca
aattcagctctaaagggaccgatgtgtgaggattgtacagggcagctgctttcggggatg
gatcaacatttaaaagaactagatgaagaatgtgcacagtaccgtgaactgcttgattcg
ttgaaagaagggagggatgctcgcttaatggacagaaatatcgtagcagcaaagcttaca
gctatgaagaatgaagaagcttctttgttggtagaatcaaagaaattggaagctgaagag
gcaaaattggacgcggaattaaaaaagaagaaaagtgaattatatgcagagaatgaatcg
gcagaattgttatggagagtatttcgtgacaaccacaggcagttaatcagaatggaaatg
aaagagcaggatctggaagctgaggtgcattgtttgaaaagtcagcgtgacagactgtcg
aaaatcaacgtgttaaatacagcatttcatatctggaagcaagggagttttggtacaatt
aatggttttcgtcttggtcagctgccacattctcaggttgaatggagcgaaatcaatgct
gcatggggacaagtggctttgctgatcaacactttagcagattgtcttgaagttcagttc
agcttatatcgtattgtgccagttggcagtcattcatttatccagtgtttggataccggg
gttgaattgccgctttttggcagtggcggttttaagccatttggacaaaaaaaattcgat
gaaggcatttgtgcttttatggaatgtttctgtcaattgcagagacatattgaacgtgcg
cagtttcgcttccctcatcgaatgtacagagaacatattgaggacaacaaaatggagtat
tctgttaaaatgcaattcaacgccgaagaaaggtggacaaaggcgatgaaatgtcttctg
atcaattttcgttgggcgatttcctatgttgtgcattccaaaatattgcgaactgaagca
gttttctcgtag

DBGET integrated database retrieval system