KEGG   Loa loa (eye worm): LOAG_02824
Entry
LOAG_02824        CDS       T02664                                 

Definition
(RefSeq) hypothetical protein
  KO
K20094  cell death protein 9
Organism
loa  Loa loa (eye worm)
Pathway
loa04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:loa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    LOAG_02824
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:loa02000]
    LOAG_02824
Transporters [BR:loa02000]
 Other transporters
  Pores ion channels [TC:1]
   LOAG_02824
SSDB
Motif
Pfam: Bcl-2 STE3
Other DBs
NCBI-GeneID: 9940214
NCBI-ProteinID: XP_003138409
UniProt: A0A1I7VA99
LinkDB
AA seq 254 aa
MRFCVVFMNRISNNGSFVFEEMNVVDLVAVKNDQYSGDTTSESMDPLRGLNIIQSYITDY
IQYRVHLHNGYCPRLPETPVSDDYRNELIRAVVLIFEKKHAEELKNMVTTLCLNGRLTFQ
RYVEVVECFTQNDEDESAEQLSYGRLVALIAFAGLVAMKLCDMQMFSEVSMIASYTSKFL
HKRIVLTWPQEKRSWENFFDRAKMIIDRNEVEASEQLNLKSECSRWWLSIRALVIFGMFG
IGAFTLMKAMLKAR
NT seq 765 nt   +upstreamnt  +downstreamnt
atgcgtttttgcgttgtatttatgaacagaataagcaacaatggaagttttgtttttgag
gaaatgaatgtcgttgatttagtcgctgtgaaaaatgatcagtatagtggcgatacgacc
agtgaatcaatggatcctctgagggggcttaatattatacagagttacatcactgattat
atccagtatcgtgtgcacctgcataacggttattgtccgcgtttgccagaaaccccagtt
tcggacgattatcgaaatgaattaattcgagcggttgtcttaatttttgaaaagaaacat
gcagaagagctcaagaacatggttacaacattatgtctaaatggaaggcttacatttcaa
cgatatgttgaggttgtagaatgttttacacaaaacgatgaggatgagtcagctgaacaa
ctatcttatggacgattggtggcattgattgcatttgctggattagttgcaatgaaactt
tgtgatatgcagatgttttcagaagtgtcaatgattgcatcttacacgtccaaattcttg
cacaagcggatcgttttaacatggccacaagagaaacgttcttgggaaaatttttttgat
cgcgcaaaaatgataattgatagaaatgaagttgaggcaagtgaacaacttaatttgaaa
tcggaatgcagtcggtggtggctatcaattagagcgttggtgatattcggcatgtttggt
atcggcgcttttacattaatgaaggctatgctgaaagcacgataa

DBGET integrated database retrieval system