KEGG   Loa loa (eye worm): LOAG_02825
Entry
LOAG_02825        CDS       T02664                                 

Name
(RefSeq) apoptosis regulator protein
  KO
K20094  cell death protein 9
Organism
loa  Loa loa (eye worm)
Pathway
loa04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:loa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    LOAG_02825
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:loa02000]
    LOAG_02825
Transporters [BR:loa02000]
 Other transporters
  Pores ion channels [TC:1]
   LOAG_02825
SSDB
Motif
Pfam: Bcl-2 DUF6154 BH4 ACDC
Other DBs
NCBI-GeneID: 9940210
NCBI-ProteinID: XP_003138410
UniProt: A0A1I7VAA7
LinkDB
AA seq 227 aa
MFTNDSIALKCDKYDECSSKWLECQDNIYCIQDFVADYIQYRVRMRGNHRTPNLIQPCRQ
GCENDLIRSVALIFEEKHEEELQKMVEMLCENESFSFNRYIEIMEHFVCIRNETPSQMSY
GRLIALIAFTGLIAIRLIDMKCFTEVSMIMSYTSIFLQKRIALTWPHHKRSWSKFFDLAR
TIIKLNKTEEAESKVERNEWWSAISRFVVFGVLSIAVFTLFKFMLRT
NT seq 684 nt   +upstreamnt  +downstreamnt
atgtttaccaatgattcaatcgctttgaaatgcgacaaatatgatgaatgtagcagtaag
tggttagaatgtcaagataacatatactgcatacaagatttcgtagctgattatattcaa
taccgtgttcgcatgcgcggaaatcataggacaccaaatttgatacagccatgtagacaa
ggttgcgagaatgatttgattcgttctgtggctttaatttttgaggagaaacatgaggaa
gagctccaaaaaatggtggaaatgttgtgcgagaatgaaagtttttcgtttaatagatat
atcgaaattatggagcacttcgtatgtattcgcaatgaaacaccgtcacaaatgtcttat
ggacgtctgatagcactgatcgcattcactggactgattgctatacggttaatcgacatg
aaatgtttcacggaagtttcaatgattatgtcatacacttcaatattcttgcagaaaaga
attgccttgacatggccacatcataagcgctcttggagtaaattttttgatcttgcaagg
acgataatcaaattgaacaaaacagaagaagcagagtccaaagtagaaagaaatgagtgg
tggtcagcaattagcagatttgttgtttttggtgttctaagcattgccgttttcacatta
tttaaatttatgcttagaacatga

DBGET integrated database retrieval system