KEGG   Loa loa (eye worm): LOAG_04028
Entry
LOAG_04028        CDS       T02664                                 

Definition
(RefSeq) hypothetical protein
  KO
K08731  baculoviral IAP repeat-containing protein 5
Organism
loa  Loa loa (eye worm)
Pathway
loa04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:loa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    LOAG_04028
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:loa01002]
    LOAG_04028
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:loa03036]
    LOAG_04028
Peptidases and inhibitors [BR:loa01002]
 Peptidase inhibitors
  Family I32: IAP family
   LOAG_04028
Chromosome and associated proteins [BR:loa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     LOAG_04028
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    LOAG_04028
SSDB
Motif
Pfam: BIR zf-C3HC
Other DBs
NCBI-GeneID: 9941426
NCBI-ProteinID: XP_003139613
UniProt: A0A1I7V703
LinkDB
AA seq 158 aa
MATVVDLLNCDAYTEHIFYNNRLKSFTKNAWPHHQSVNLSPEKMAQAGFFFDPDSDNADN
VSCPFCLRSLTGWEDSDDPLVEHTKRKDVCYFARLGKDEKEWTVEDFLRLLAQRRASTMS
LIALKAIDGARNAMKSVKKRIDVLTENKRQKKTAKRKK
NT seq 477 nt   +upstreamnt  +downstreamnt
atggcaacagttgttgatttgctaaattgtgacgcttacaccgagcatatcttttataat
aatcgattgaaatcatttacaaaaaatgcttggcctcatcatcaatccgttaatttatct
ccggaaaagatggctcaggcaggcttcttcttcgatccagatagcgataatgctgataat
gtcagttgtccattttgccttagaagtttgaccggatgggaagatagtgatgatccttta
gtagagcatacaaaacggaaggacgtttgctactttgcacgtttaggcaaagatgaaaag
gaatggacagttgaagacttcttacggcttctggctcaacgaagagcatctacgatgtca
ttaattgcactgaaagcgatcgatggtgcgagaaatgctatgaaaagcgtgaaaaagcga
atagatgtactgactgaaaataaaaggcaaaaaaagacagcgaagaggaagaagtaa

DBGET integrated database retrieval system