KEGG   Loa loa (eye worm): LOAG_05968
Entry
LOAG_05968        CDS       T02664                                 

Definition
(RefSeq) cytochrome c type-1
  KO
K08738  cytochrome c
Organism
loa  Loa loa (eye worm)
Pathway
loa04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:loa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    LOAG_05968
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Cytochrome-c551
Other DBs
NCBI-GeneID: 9943376
NCBI-ProteinID: XP_003141552
LinkDB
AA seq 108 aa
MSIPEGDYERGKKLFKMRCLQCHVIDSDANKNGPTLKGVIGRKSGTVDGYPYSTANKNKG
VVWTRETLFEYLLDPKKYIPGTKMVFAGLKKPQERADLIKYIEEESPK
NT seq 327 nt   +upstreamnt  +downstreamnt
atgtcaataccggaaggtgattacgagagaggcaagaaattattcaaaatgcgatgcctt
caatgccatgtaatagattcggatgcgaataaaaatggcccaacattgaagggtgtgatt
ggacgtaagtcaggtactgtcgatggctacccatattctaccgccaacaaaaataagggc
gtggtttggacccgtgaaacgttatttgaatatttattagatccgaaaaaatatattccg
ggaacgaagatggtatttgcgggcctgaagaaacctcaagaacgtgccgacttgatcaaa
tatatagaagaggaatctccgaaataa

DBGET integrated database retrieval system