KEGG   Loa loa (eye worm): LOAG_06645
Entry
LOAG_06645        CDS       T02664                                 

Definition
(RefSeq) Ras association domain family 1 isoform A
  KO
K09850  Ras association domain-containing protein 1
Organism
loa  Loa loa (eye worm)
Pathway
loa04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:loa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04392 Hippo signaling pathway - multiple species
    LOAG_06645
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Ras_bdg_2
Other DBs
NCBI-GeneID: 9944059
NCBI-ProteinID: XP_020302549
LinkDB
AA seq 439 aa
MSKTLDYGVDSSNGNDGKHMRSRQSATQQSRWFSGLRARISQLNMPEWLSQLGVRNFSYI
VPTEEVLPSDKAEEKVDCKDDQPEQRLDDVSEKLETCCDPGIDVNGSDTIGSWLWEEAGY
DDTLALQHFGPLKNLITGCSHPGKGHDFLSLSVTHPTWCDKCGDFMWGFLTRAVKCDNCN
YTCHAKCRSLVTLDCKTADSTLNSCHELAVTSCSNLKMFTENDDILEEQKDETSGFVQIH
MNFMRPINVVAGDSLSFLDVTNESGSITTSSLRTITTFFLPRNTIKNVNISSKMTTREMI
VTLLRKFRVADNPRKFALYERVCQFPESPNVQNFSLTRIPDESFPLKIVRLWEEKGEKRQ
LVLQENDTGDILWDMFEVPELENFLKILEDEEKQYSFRIRQKYDAYRWYLDENLRNRGFT
VDNDEFSSVKANSCISTDV
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgagtaagaccttggattatggtgtggatagtagcaacggaaatgatgggaaacatatg
cgatcacgtcaatctgccacgcaacagtcgaggtggttttccggattacgtgcaaggatc
tcacagcttaatatgccggaatggttgagccaacttggagttaggaatttcagttatata
gtaccaacagaggaagtgttacccagtgacaaagccgaagaaaaagtggactgcaaagat
gatcaaccggagcagaggctggatgatgtttcagagaagttagagacatgctgtgatcca
ggaatagacgtaaatggaagtgatacgataggctcgtggttatgggaagaagctggttat
gatgatacccttgctttgcagcactttggcccattgaagaatcttattacaggttgtagt
catccaggaaaaggacacgatttcttgtcactatctgttacccatccaacctggtgtgac
aaatgtggagattttatgtggggatttttgacacgagctgtgaagtgtgataactgcaat
tacacttgtcacgcaaaatgtagatcgctggtaacacttgattgcaaaacggccgatagt
accttgaattcgtgccatgaattagctgtaacttcttgttcaaatctcaaaatgttcact
gaaaatgacgacattcttgaggaacaaaaagatgaaacgagcggttttgtacaaattcac
atgaattttatgcgacctataaatgtggtagcaggcgattcactttcatttttggatgtt
actaatgaatcagggtctataactaccagttccttaaggacaatcacaacatttttcctt
ccgagaaatactataaagaatgtgaatataagtagcaaaatgactaccagagaaatgatt
gtaactttactgcggaaattccgagttgcagataatccacggaagtttgcactgtatgaa
cgcgtctgtcagtttccagaaagtccaaatgtacagaattttagtttaacccgcattccg
gacgaatcatttccgcttaaaattgtgcgcttatgggaagagaagggtgagaaacggcaa
ttagttttacaggagaacgatacaggcgatattttgtgggatatgtttgaggttccagaa
cttgagaactttttaaaaatattggaagatgaagagaaacaatactcttttcgtattcgg
cagaaatacgatgcttacaggtggtatttggatgaaaatttacgtaatcgaggttttaca
gtggataatgatgaatttagctcggtaaaagcaaattcttgtatatccactgacgtttag

DBGET integrated database retrieval system