KEGG   Loa loa (eye worm): LOAG_08740Help
Entry
LOAG_08740        CDS       T02664                                 

Definition
(RefSeq) angiotensin-converting enzyme family protein
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
loa  Loa loa (eye worm)
Brite
KEGG Orthology (KO) [BR:loa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:loa01002]
    LOAG_08740
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:loa04147]
    LOAG_08740
   04090 CD Molecules [BR:loa04090]
    LOAG_08740
Enzymes [BR:loa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     LOAG_08740
Peptidases [BR:loa01002]
 Metallo Peptidases
  Family M2
   LOAG_08740
Exosome [BR:loa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LOAG_08740
CD molecules [BR:loa04090]
 Proteins
  LOAG_08740
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 EB
Motif
Other DBs
NCBI-GeneID: 9946166
NCBI-ProteinID: XP_003144317
UniProt: A0A1I7V5E5
LinkDB All DBs
AA seq 1028 aa AA seqDB search
MIRRTLLLQQLIISVVLLRLHAQHEDNSSGQNGSRKDTGISTLESSLTLSRNSAIWPTLM
QSTVNDAPIIAAAEAKNILRTYSIAKQPTPLSKLSSQNHSTEFSAQPNSKPEPEQEIVSS
SSFHPTISKSGFHHQPILTTTAKFAKPFADGSSHLAMHSAQVPQLTVHGEDPQPLPEPNA
VKVSGASLMPSYQNNAFEDDTEQFDDEDDSSADSSRPGAIDNEAIEELVNRFLNGDDTED
GKEEKLNKEALKLINSSKYWDLNNLQPENSIRDSKKAQEWMNGYAVEAQKVLREVALAGW
NYVTSVSHLTKQLLDEAEETLGKFVKSTSKQAKQFDTKAIEDESLKRQFELLLVEGINVL
DENDFNEYNELQKLIAKAYAETSVCETSNATICPYRVSDIVSIIAHENDGPKAFRFWIAL
REALGPKLVTSYKRLIELINKGAKLNGFPDGGAMWRSPYERFASRREKTEQSDTVALLQK
LYQQINPFYKQLHAYIRRQIPALYGLANVSNLTRDGPIPAHLLKSIASDNWVAFYRDTKP
YQDEDHLAREVQENFQKLNYTVKNMFKQTYKTLKQLGFDKLPSSFWTKSIFTRTWSKDML
CHPPAAYDMRDKHDYRIKACAHLNLPDFELTHKLLVHIYHYYMCRDQPLLFREATNPSLL
TAVTNAFAINARNIEYLKMMKLITSETGFSHSKIINRLYLEALEDFVKLPFDFAVDMWRF
HIFDGTSTNATWNSDWWQLSELFQGIKSPVERKSTDFDAIAFSTIAQTHAPAMKHFFAYI
MQFQILKALCPDTTNLSNGCMLERNSVIDKIKKVMALGSSITWREALEIITGSKEVDASA
MLEYYQPLISWLEEQNAKEHAYIGWDGFGKPFEESEVPKVRESTTSTDSLSEILSGSQFA
FPGGDCSNGKECLLDSVCQNDLCECKEGLYTLKIGNTYNCVPGNPADAGFGDGHGGLVIG
LHSIDDNSIVAIPEPEEHEKQMKAEPEPELANDKPGFLPEQELKSKGTSASIPTLTLVLS
LTVLVVLL
NT seq 3087 nt NT seq  +upstreamnt  +downstreamnt
atgataagaaggacgttactgttacagcagttgataatatcagtggttctgcttcgtctt
catgctcaacatgaagataattcatctggacaaaatggatccagaaaagatactggcata
tcgacattagaaagtagtctgacactatccagaaattctgcaatatggcctacattgatg
caaagtacggtgaatgatgcaccaataatagcagcagcggaagcaaaaaatattcttcga
acttattccattgctaagcagccaactcctttgagtaaattatcatcccagaaccattct
acagagttttcggctcaaccaaattcaaaacctgaacctgaacaagaaatcgtctcatcg
tcaagttttcatcccactatttctaaatcaggatttcatcatcaaccaatactaactacc
actgccaaatttgctaaaccatttgctgatggttcttcacatttggctatgcattcagcc
caagttccacaacttacagttcatggtgaagatccccaaccacttccagaaccgaatgca
gttaaagtaagcggcgctagccttatgccatcataccaaaacaatgcattcgaggatgat
actgaacaatttgacgacgaagatgatagtagtgcggattcttcgagaccaggtgctatt
gataatgaagctatcgaggaacttgttaaccgcttcttgaatggtgatgatacggaagat
ggaaaagaagagaaactcaataaagaagctctgaaactgatcaattcgagtaaatactgg
gatttgaacaatttacagcctgaaaattcgatacgagatagtaagaaagctcaagaatgg
atgaatgggtatgctgttgaggcacaaaaagtattgcgtgaagtagctttagccggatgg
aattatgtcacatcagtatcgcatcttactaaacaacttcttgatgaagctgaagagacg
ttaggaaaatttgtgaaaagcacctcgaagcaagcgaagcagtttgatactaaagcaatt
gaggatgaatcgctgaaacgacaatttgagcttcttttggtagaaggcatcaatgtcttg
gatgaaaatgatttcaatgaatacaatgaacttcaaaagctgatagcaaaagcgtatgct
gaaacttcagtttgtgaaacgagcaatgcaacgatatgtccttacagagtttccgatatt
gtatcaattattgcccatgagaatgacggccctaaagcatttcgtttttggatcgcattg
cgtgaagcattaggaccgaaactggttacctcttacaaacgtctcatcgaattgattaat
aaaggagctaaattgaatggttttccggatggtggagcgatgtggcgtagcccttacgaa
cggtttgcatcgcgtcgtgaaaaaacagaacaaagtgacaccgttgctcttttgcagaag
ttataccagcaaattaatccattttataaacagttgcacgcatatataagacgtcaaata
cccgctctgtatggcctagcaaacgtgtctaatctaacacgagatggtcctatcccagca
cacttgcttaagagtattgctagtgacaactgggtcgccttctatcgggatacgaaaccc
taccaggatgaggatcatcttgcaagggaggttcaggaaaacttccaaaaattaaactat
actgtgaaaaacatgttcaaacagacttataaaactctcaagcaacttggatttgataaa
ttaccgtcaagtttttggacgaaatcgatatttacgaggacctggagtaaagatatgctt
tgtcatccacctgcagcttacgatatgagggataagcatgattataggataaaagcatgt
gcacatcttaatttacccgattttgaattgacccataaattgcttgttcacatataccat
tattatatgtgtcgtgaccaacctcttctgtttcgtgaagcaacaaatccaagtctttta
accgctgtgactaacgctttcgcaattaatgctcgaaatatagagtatttgaaaatgatg
aaactaatcacatcggaaactggatttagtcactcaaaaattatcaatcgtttgtatttg
gaagcacttgaagatttcgtcaaactacccttcgacttcgcggttgatatgtggcgattt
catatatttgatggtacttcaacaaatgctacctggaactctgattggtggcaactaagt
gaattattccaagggatcaaatcgccagtggaacgaaaatcaactgatttcgacgccatt
gcattttctaccattgctcaaacgcacgctccagcaatgaaacactttttcgcctacata
atgcaattccaaatcctcaaagctttgtgtcctgatacgacaaatttgagcaatggatgt
atgttagaacgtaattcagttattgataaaattaaaaaagtgatggcacttggttcatca
attacttggcgcgaagcattggaaattattacaggtagcaaagaagttgatgcaagcgct
atgctggaatattatcaacctctgataagttggcttgaggagcaaaacgctaaggaacat
gcgtatattggatgggatggattcggaaagccatttgaggaatccgaggtaccaaaagtt
cgagaaagtaccaccagtacggactcgttatccgaaatattgagtggaagtcaatttgca
tttccgggtggtgactgctcaaatggtaaggaatgcttgctggattcggtatgtcaaaat
gatctctgcgaatgcaaggagggactatatactttgaagattggcaatacttataactgt
gttcccgggaatcctgctgatgcaggttttggagatggacatggtggtttagtcatcggt
ttacattcaatagatgacaacagtatagtggctattccagagcctgaggagcatgaaaag
cagatgaaagcagaaccagaaccagaacttgctaatgataagccaggtttcttgccggaa
caagaactaaaatctaaaggaacttctgccagtataccaacattaaccttggtattatca
cttactgtcttggtcgtactgttatag

DBGET integrated database retrieval system