KEGG   Loa loa (eye worm): LOAG_11693
Entry
LOAG_11693        CDS       T02664                                 

Definition
(RefSeq) CMGC/MAPK/JNK protein kinase
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
loa  Loa loa (eye worm)
Pathway
loa04010  MAPK signaling pathway
loa04012  ErbB signaling pathway
loa04068  FoxO signaling pathway
loa04137  Mitophagy - animal
loa04140  Autophagy - animal
loa04141  Protein processing in endoplasmic reticulum
loa04212  Longevity regulating pathway - worm
loa04215  Apoptosis - multiple species
loa04310  Wnt signaling pathway
loa04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    LOAG_11693
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    LOAG_11693
   04012 ErbB signaling pathway
    LOAG_11693
   04310 Wnt signaling pathway
    LOAG_11693
   04068 FoxO signaling pathway
    LOAG_11693
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    LOAG_11693
   04137 Mitophagy - animal
    LOAG_11693
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    LOAG_11693
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    LOAG_11693
  09149 Aging
   04212 Longevity regulating pathway - worm
    LOAG_11693
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:loa01001]
    LOAG_11693
Enzymes [BR:loa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     LOAG_11693
Protein kinases [BR:loa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   LOAG_11693
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Kinase-like Kdo RIO1 APH
Other DBs
NCBI-GeneID: 9949151
NCBI-ProteinID: XP_020301457
LinkDB
AA seq 389 aa
MSFNTNLFHQIKVKGRSTDALFTVPKQYINLSYLSTGAQGIVVKAYDTVAQEQVAIKKII
HPFLTTMTARRTYREFVLLMTMKHPNIILLKNAFTPHQSLDDFDDIYVVMELMNYNLSQV
IKQLKLDNKNLSYFTYQMIVAIKYMHRSGIIHRDLKPSNIVVNDKCILKILDFGLARKIE
TGERMTVYVVTRYYRAPEVILGLPYDEKVDVWAIGCILAEMINRKTLFPGTDRLDQWNKI
IEILGTPSQEFINKLEHHTKNYVRSKGHNDPLPFEKIFPDECFIGSYSKAPQLCASVARD
LLFKMLQIDPEKRISVDEAVRHPYVNLWFRDEEWNVSLPENRYDANYDLTELPINSWKEL
LFKEVKRCEKEHSLENTNSNITYPTDNFK
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgagttttaatacaaatttatttcatcaaattaaagtgaaaggacgctcaacagatgct
ttatttactgtccccaagcaatacatcaatctttcgtatcttagcactggtgctcaagga
attgttgtaaaagcatatgatacagtagcgcaggaacaagttgcaatcaaaaaaatcatc
catccatttctaacaacaatgaccgctcgtcgaacatatcgagaatttgtcctgctcatg
acaatgaaacatcctaatataatactactcaaaaatgcttttacgccacatcaatcattg
gatgattttgatgatatttatgttgtaatggaattaatgaattataatttatcacaagtg
attaagcaattaaaattggacaacaaaaatctttcatatttcacatatcaaatgattgtt
gcaattaaatatatgcatcgtagtggaattattcatcgggatttgaagccaagtaatatt
gtagtaaatgataaatgcatcttgaaaattcttgattttggcttagcaagaaaaattgaa
acaggcgaacgtatgactgtttatgttgtgacacgatactatcgtgcaccagaagtgatc
cttggccttccatatgatgaaaaagttgatgtttgggcaattggttgcatattagccgaa
atgatcaataggaaaactttattcccgggtaccgatcgacttgatcaatggaataaaatt
attgaaattttgggaacaccaagccaagaatttattaataaattagaacatcatactaaa
aattatgttagaagtaaaggacacaatgatccattaccatttgaaaaaattttcccagat
gaatgcttcattggaagttattcgaaagcaccacagctttgtgcttccgtggcacgtgat
ttactattcaaaatgctccaaattgatccggaaaaacggataagtgttgatgaagcagta
cgtcatccttacgtaaatttatggtttagagatgaggaatggaatgtatcacttccagaa
aatcgatatgatgcaaattatgacctcaccgaattaccaataaattcatggaaagaactt
ttattcaaagaagtgaaacgttgtgagaaagaacattcgttagaaaatacaaattcaaac
atcacatatccaactgataatttcaaatga

KEGG   Loa loa (eye worm): LOAG_17611
Entry
LOAG_17611        CDS       T02664                                 

Definition
(RefSeq) CMGC/MAPK/JNK protein kinase
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
loa  Loa loa (eye worm)
Pathway
loa04010  MAPK signaling pathway
loa04012  ErbB signaling pathway
loa04068  FoxO signaling pathway
loa04137  Mitophagy - animal
loa04140  Autophagy - animal
loa04141  Protein processing in endoplasmic reticulum
loa04212  Longevity regulating pathway - worm
loa04215  Apoptosis - multiple species
loa04310  Wnt signaling pathway
loa04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    LOAG_17611
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    LOAG_17611
   04012 ErbB signaling pathway
    LOAG_17611
   04310 Wnt signaling pathway
    LOAG_17611
   04068 FoxO signaling pathway
    LOAG_17611
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    LOAG_17611
   04137 Mitophagy - animal
    LOAG_17611
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    LOAG_17611
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    LOAG_17611
  09149 Aging
   04212 Longevity regulating pathway - worm
    LOAG_17611
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:loa01001]
    LOAG_17611
Enzymes [BR:loa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     LOAG_17611
Protein kinases [BR:loa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   LOAG_17611
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo ABC1 RIO1 APH Kinase-like TCAD9
Other DBs
NCBI-GeneID: 9940365
NCBI-ProteinID: XP_020306077
LinkDB
AA seq 611 aa
MSSSQHTALDRKDYLHCTARTCTASHDTQHQSTQAGHTLLGADSPTGVHGGRASLGSIIR
GTKGHLFSILGSVTQWLGSSNSGGRDDCETEAISLDSCASVLEPSYLEGVYPTPMASTSA
ASEFYNVDINDTRLCVLKRYQNLRIIGSGAQGVVCAAHDTLRDEQVAIKKLSRPFQNVTH
AKRAYREFKLMNLVNHKNIIGLLNAFTPQKTLDEFSDLYIVMELMDANLCQVIQMDLDHE
RMSYLLYQMLCGIRHLHAAGIIHRDLKPSNIVVKSDCSLKILDFGLARSAGDSFMMTPYV
VTRYYRAPEVILGMGYKDNVDVWSTGCIFGEMIRGSVLFPGSDHIDQWTKIVEQLGTPSP
MFMRRLQSTVRNYVENRPHFLGFPFDKLFPDELFPASSSSDSRLTVDIWSIGCIFGELIR
GRVLFPGTDHIDQWSKIIEQLGTPGRDFMQKLQATVRSYVENRPRHPGLPFEILFSDNIF
PKPATNSALCPAQARDLLSKMLVIDPEKRISVDEALKHPYVYVWFDEAEVYAPPPEQYNH
SIDSRDHTVEQWKELIFKEIMHYEQTHDEYGIKKSLNCTSAAAPSSSSSSFQNIEHGDCS
TTGSTLVTNGL
NT seq 1836 nt   +upstreamnt  +downstreamnt
atgtcatcctcgcaacatactgccttggatcgcaaagactacctccactgcactgcaaga
acttgtactgcaagccacgacacacaacatcaatctacgcaagccggacatactttgctg
ggagcagatagtccaactggtgttcacggtggtagagcctcgttggggtcaatcatacgg
ggcaccaagggacatttattcagtatacttggtagtgtcacacagtggctgggaagttcg
aattcaggtggtcgtgacgattgcgagacagaagcgatttcgctcgacagttgcgcaagc
gttttggagccgtcctatcttgaaggcgtttatccaactcccatggcttccacttctgct
gcatccgaattttacaacgttgacatcaatgacacacgtttgtgtgttttgaagcgctat
caaaatttaaggataatcgggtctggtgcacagggtgtcgtatgtgctgcacatgatact
cttcgtgatgagcaagtcgctattaagaagctgagtcgtccgttccaaaatgtgacgcat
gctaaacgagcttacagagagttcaaattgatgaatcttgtcaaccataaaaatataatt
ggattgttgaatgcattcacacctcaaaaaacactcgatgaattttccgatttgtacata
gtaatggaacttatggatgctaatttatgccaagtaatccaaatggacttagatcatgaa
aggatgtcctatttgttgtatcaaatgttatgtggtatcagacacttgcatgctgcgggt
atcatacaccgggatctcaaaccgagcaatattgttgttaaaagtgattgtagtttgaaa
atattggattttggtttagcgcgaagtgccggtgattcatttatgatgacgccatatgtt
gtaacacgttactatcgtgcacctgaagttatactagggatgggatacaaagataatgtt
gatgtttggtcaacgggctgtatattcggcgaaatgattcgtggtagtgtattgtttccg
ggcagtgatcatattgaccagtggaccaaaattgttgagcagcttggtactccttcaccg
atgttcatgcgtcgcttgcaatcaactgtccgaaattatgtggaaaatcggccccatttc
cttggttttccattcgataagctcttcccggatgaattatttccagctagcagcagttct
gactcacgacttactgttgatatatggtcgattggctgtatttttggtgaactcattcgt
ggccgagttcttttccctggtacggatcatattgaccagtggtcaaaaatcattgagcag
ctgggaacacccggacgagattttatgcagaagttgcaagcaactgtgaggagctatgtg
gagaatcgtcctaggcatcccggtcttccatttgagattctctttagtgataatatattt
ccaaagccagcaaccaacagtgcactttgcccagcgcaagcacgtgatttgctgtcgaaa
atgctggtgatcgatcccgaaaagcgcatatcagtggatgaagctctgaaacatccttat
gtttatgtgtggttcgacgaagctgaagtttatgctccaccaccagaacaatacaatcat
agtattgactcgagagatcatacagttgaacagtggaaagaactaatattcaaagaaatc
atgcactacgagcaaacgcatgacgaatatggaataaagaaatcgttaaattgtacatca
gctgctgcaccatcgtcttcatcatcatcatttcagaacattgagcatggtgattgctca
acaactggaagtactctggttacaaatggcttgtga

DBGET integrated database retrieval system