KEGG   Loa loa (eye worm): LOAG_17874Help
Entry
LOAG_17874        CDS       T02664                                 

Definition
(RefSeq) BcDNA
  KO
K00665  fatty acid synthase, animal type [EC:2.3.1.85]
Organism
loa  Loa loa (eye worm)
Pathway
loa00061  Fatty acid biosynthesis
loa01100  Metabolic pathways
loa01212  Fatty acid metabolism
Module
loa_M00082  Fatty acid biosynthesis, initiation
loa_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:loa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    LOAG_17874
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:loa01004]
    LOAG_17874
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:loa04147]
    LOAG_17874
Enzymes [BR:loa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.85  fatty-acid synthase system
     LOAG_17874
Lipid biosynthesis proteins [BR:loa01004]
 Fatty acid synthase
  Animal type
   LOAG_17874
Exosome [BR:loa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   LOAG_17874
  Exosomal proteins of breast milk
   LOAG_17874
  Exosomal proteins of colorectal cancer cells
   LOAG_17874
  Exosomal proteins of bladder cancer cells
   LOAG_17874
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: KR Thioesterase ADH_zinc_N_2 ADH_zinc_N adh_short PP-binding Abhydrolase_1 FSH1 Polysacc_synt_2
Motif
Other DBs
NCBI-GeneID: 9950341
NCBI-ProteinID: XP_020305768
LinkDB All DBs
AA seq 1004 aa AA seqDB search
MHLYKDADHAFINTLIRGDVSSLTWFESPNQFFDDTCQKNPSLELCHVYYSAINFRDVML
AYGRLPPDAIPGQFADRECLLGMEFSGRLKDGIRLMGILPAQALATSVIVDREYAWTVPD
NWSLADAATVPIVYTTAYYALVMRGRIRRGDKVLIHGGSGGVGQAAIAVALSRGCEVYTT
VGNAEKKAFLQKRFPQLTDRHFANSRNSDFELHIRHQTRGRGVDVVLNSLAQHMLQASVR
CLAQNGRFLEIGKVDLSQNSPLGMAVFLKNITFHGILLDAVMDPSEVARLVQDGIKSGIV
QPLSYTAFSSEKAEEAFRFMSSGKHIGKVLMEIRQEEPERVCLPSPIRVRAICRTLCHPN
YVYLITGGLGGFGLELSQWLINRGAKKLVLTSRMGIRTGYQARCVHFWRRTGISVLVSTL
NIAHLSDAHELISQCKGLGPVGGVFHLAMVLRDCLFENQNVQNFKDAAEAKYWGTLNLDA
ATRNACGKELRWFVAFSSITSGRGNAGQTNYGWSNCTMERIIEHRREDGLPGIAIQWGAI
GDVGVILENMGDNNTVVGGTLPQRMPSCLAALDLFLSWNHPIVASYIKADIGAKKVGSSG
NLWQTMAHILGVNDAAQLNPDAYLGDLGLDSLMGVEIKQALERDYDIVLSMKDIRTLTLN
KLQQLVDSGGTTSTVLQTTELELKKESEKEAEQNTVEQLERQMNQLFKMRVDVNDLEPMD
LIVKCNKVETGPPTFFVHSIEGIATPLKKVMSKCNFPAYCFQSTREVPQDSIEKVAQKYI
LEMKKIQPEGPYRIIGYSYGACIGFEMATMLQESDGANSVERLILLDGSHLYMQTYRNVY
RMAFGVTGDTLVNNPLFESEIMCAMTLRFANVDYKKFRVELLQQPGFKARVQKVVDTVMT
TGLFKSADTIDFACCAMRSKFVMADKYKPERKFKGLITLIRAEQGAAREEDVGSDYGISQ
VSDENNVYIVGGDHDSFVQGKTSAETVNIINDLIAETNKKAKNV
NT seq 3015 nt NT seq  +upstreamnt  +downstreamnt
atgcacttatataaagatgcagaccatgccttcatcaatactttgattcgcggtgatgtt
agttcattgacatggttcgaatcaccgaatcagttctttgacgatacctgtcaaaagaac
ccttcgctagagctatgccatgtctattattcagccattaatttccgcgatgtcatgctt
gcatatggacgactcccaccggatgctatcccaggacagttcgcggatcgcgaatgctta
ttgggtatggagttttcgggacgattgaaggatggtattcgtttgatgggtatactgcca
gcgcaagctttagcgacctctgtaattgttgatcgtgaatatgcttggaccgttccggat
aactggtcactcgcggacgctgcaacggtaccaatcgtatacaccactgcatactatgcg
cttgtgatgcgtggtcgtattagacggggtgacaaggttttaattcatggaggttcgggt
ggtgttggccaagctgcaattgctgttgctttatcacgtggttgtgaagtttataccaca
gttgggaatgctgaaaagaaggcatttttgcaaaaacgtttcccacagttaacagataga
cattttgcgaattcacgaaattccgattttgagcttcatatcaggcatcaaacaagagga
cgcggagttgatgttgtccttaattcattagcacaacatatgttgcaggcttctgttcga
tgtcttgctcaaaatggacgattcttagaaataggtaaagtagatttatctcaaaattca
ccacttggtatggcggtgttcctcaaaaatattactttccatggtatacttctggatgcg
gtgatggatccgagcgaagtagcgcgtttagtccaggacggaatcaaaagcggaattgtg
caaccgctttcgtacacggcattttcaagtgaaaaagctgaggaagcgttccgcttcatg
tcgtctggcaaacacatcggaaaggttttaatggaaattcgacaagaggaaccggaaaga
gtgtgtttgccgtcaccaattagggtgcgagcgatatgtcgtacattatgtcacccaaat
tatgtttatctcattactggtggtctcggtggatttggtttagaactgtcacagtggctg
attaataggggtgctaaaaaattggtgctaacttctcgaatgggaatccgaacaggttat
caagctcgttgtgttcacttttggcgtcgaacgggtatttcggttcttgtttcaacgctc
aatatcgcacatctatcagatgcccatgagttgatatcacagtgcaaaggattgggtcca
gttggcggtgtcttccatcttgccatggtattacgcgattgtttgtttgaaaatcaaaat
gtacaaaatttcaaagatgctgctgaagcaaaatactggggaacattgaatctagatgct
gctactagaaatgcatgcggtaaagaacttaggtggtttgtcgcattttcgtcaatcact
tcgggacgtggaaatgctggacaaacaaattatggctggtccaattgtacaatggaaagg
atcattgaacatcgtcgagaagatggtttaccgggtattgcaatccaatggggagcgatt
ggtgacgtaggagttatcctggaaaatatgggtgataataacactgttgttggtggtact
ttaccgcaacgaatgccttcttgcttggctgctttggatttattcttatcttggaatcat
cctattgttgccagttacatcaaagcagacattggtgctaaaaaagttggaagtagtgga
aatttgtggcaaacaatggcccatattttgggtgtgaatgatgcagcacagttgaatcca
gatgcttacttaggtgatttgggactcgattcacttatgggtgttgaaattaagcaagct
cttgaacgagattatgacatcgttttgtccatgaaagatattagaacactgacgttaaat
aagcttcaacaattggtagattctggtggaacaacttcaacagtgttacaaacaactgaa
cttgaactgaagaaagaaagtgaaaaggaagctgaacaaaacactgtcgaacaacttgaa
aggcaaatgaatcaattatttaagatgagggtcgatgtgaacgaccttgaaccaatggat
cttatagtaaaatgtaacaaagttgaaactgggccaccaacgttctttgtgcattcaata
gaaggaattgccacaccgttgaagaaagttatgtcgaagtgcaacttcccggcatactgt
ttccagtcaactagggaagtaccacaagactcaattgaaaaagttgcacagaaatatata
ttggaaatgaaaaagatacaaccggaaggaccatatcgtataataggttattcctatggt
gcttgtattggtttcgaaatggcaacaatgctccaggaaagtgatggtgcgaactctgtt
gaaagacttatactacttgatggatctcatctttatatgcaaacttatagaaatgtttat
cgaatggcgtttggtgtgaccggtgatacacttgtcaacaatccactttttgaatctgaa
attatgtgtgctatgacgttacgctttgcaaatgttgactacaaaaagttccgagttgaa
ctgttacaacagcctggatttaaagcccgagttcagaaggttgtggacacggtaatgacg
acaggcctcttcaaatcagctgatactattgacttcgcatgctgtgcgatgcgttccaag
tttgttatggctgataagtacaaaccagaacgaaaatttaaaggactgataactctaata
agagcagaacaaggagccgcaagagaggaggatgttggctctgattacggcatttcacag
gtgtccgacgaaaacaatgtatacatcgtgggaggtgaccacgacagcttcgttcaaggt
aaaacttctgcagaaacggtgaacataatcaatgacttgattgcggaaacaaataagaaa
gctaaaaacgtataa

DBGET integrated database retrieval system