KEGG   Loa loa (eye worm): LOAG_18542Help
Entry
LOAG_18542        CDS       T02664                                 

Definition
(RefSeq) glycogen synthase
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
loa  Loa loa (eye worm)
Pathway
loa00500  Starch and sucrose metabolism
loa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:loa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LOAG_18542
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:loa01003]
    LOAG_18542
Enzymes [BR:loa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     LOAG_18542
Glycosyltransferases [BR:loa01003]
 Polysaccharide
  Storage polysaccharide
   LOAG_18542
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 9947779
NCBI-ProteinID: XP_020305032
LinkDB All DBs
AA seq 696 aa AA seqDB search
MSGSTTPQRRLSRRLTHTKIVRELLALENATVAEMDHGEKARREGRFVFECSWEVANKVG
GIYTVLRTKASVTTEELGDQYCMLGPYKEERVKLEVEILQPDSSPLKYAMDQLNDLGLKA
TYGRWLIDGYPKVVLFDIGSAAWKLDQWKQELWDSCKIGIPYHDSESNDAVILGFMVAIF
IQKYLYAIEGYQPLYVAHFHEWQAGIGLILSRLWKTDVSTIFTTHATLLGRYLCASGADL
YNNIDKFDVDREAGIRQIYHRYCIERAAANLAHIFTTVSEITGLEATHLIKRKPDILTPN
GLNVVKFAALHEFQNLHSVAKEKIHDFIRGHFYGHYDFNLDKTIYLFTAGRYEFTNKGGD
FFIEALARLNYLLKTSADPNCKDVTVVAFIIYPAAANSFNVESLKGQAVCKQLHNTISKI
KENLASRMFEACLKGRIPEMEDLLLPDERIQLKRCILSAKRDNLPPICTHNMLDDACDPV
LNAFRRTQLINQPYDRVKVIFHPEFLSSVSPLMNLDYEDFVRGCHMGVFPSYYEPWGYTP
AECTVMGVPSVTTNLSGFGCFIQEQVQDPHTFGIFVIDRRFKGHNEAIDELAKTLYDFTL
LSRRQRIIMRNRTERLSELIDWKTLGTFYREARRKALEATHPNFMQVIEETVKKMPRPTS
APSTPATSRSVSPYDSEESDTAEQEAFEAKAWVEAN
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggatcgacaacacctcaaagacgtttgtcacgtagacttacgcatacaaaaatt
gtcagggaacttttggccttagaaaatgctacagttgctgaaatggatcatggcgaaaaa
gcacgtcgagaaggtcgctttgtttttgaatgctcctgggaagtggctaacaaagttggt
ggaatatatacagtgttacgaacaaaagcatcggtgacaactgaagaattaggcgatcaa
tactgcatgttgggtccatacaaggaagaacgagttaagttagaagttgaaattttacaa
cctgattcatcgccattgaaatatgctatggatcaattaaatgatcttggccttaaggct
acttatggtagatggctaattgatggttacccaaaagtggtactgttcgatataggttcg
gctgcttggaaacttgatcagtggaaacaagagctatgggattcgtgtaaaatcggtata
ccatatcatgatagcgaatcgaatgatgctgtcatattgggttttatggttgcaatattc
atccaaaagtatttatacgcgatcgaaggttatcaaccactgtacgtagctcattttcat
gaatggcaagctggtattggtcttattttatccaggctatggaagacggatgtttcgaca
atttttacaacacatgctaccttacttggccgatacctatgtgcatccggtgcagatcta
tacaacaatattgataaatttgatgttgatcgcgaagcaggaatacgccaaatttaccac
agatattgtatcgaaagagcagcagctaatttggcgcatatttttacaactgtaagtgaa
ataacaggtcttgaagcaacacatctgattaaaagaaagccggatattttgacgccaaac
ggtttgaatgtggtcaaatttgcagccttacatgaatttcaaaatttgcattcagttgca
aaagaaaaaattcacgattttatccgtggacatttttatggacattatgatttcaatttg
gataaaacaatttatctgtttacggccggacgttatgaatttacaaataaaggtggtgac
tttttcatcgaagcattggcaaggttaaattatcttctaaagacatcagctgatcccaat
tgtaaagatgtcaccgtggttgcatttattatttatcctgctgcagcaaattcattcaat
gtggaatcattgaaaggacaagcggtatgcaagcaattacataatacaatatcgaagata
aaggaaaatttggcatcgagaatgttcgaagcatgcttgaaaggtcgcataccggaaatg
gaggatttgctacttccggatgaacgtatccaattgaaacgttgcatattgagtgcaaag
cgtgataatttgccgccaatatgtacgcataatatgcttgatgatgcctgtgatcctgta
ttaaatgctttccgacgtactcaacttataaatcaaccgtatgatcgcgttaaagtaata
ttccatccggaatttttatcatctgtttcacccttaatgaatttggattatgaagatttt
gttcgcggttgtcatatgggtgtttttccgagttactatgaaccgtggggatatacacca
gctgagtgtacggtaatgggtgttccatcagttacaaccaatctctcaggatttggatgt
ttcatccaggagcaagtacaggatcctcatacatttggaatttttgttatcgatcgtcgg
ttcaaaggacataatgaggctattgatgaacttgcaaaaactctttatgacttcacatta
ctttcgcgccgccagcgtattattatgcgaaaccggacggaacgactcagcgaacttata
gattggaaaactctcggaacgttttatcgggaggcacgacgaaaagcacttgaagctacg
catccaaatttcatgcaagtaatcgaagaaactgtgaagaaaatgcctcgtccaacttca
gcaccatcaacaccggctacaagtcgatccgtatcaccctacgacagcgaagaatcagat
actgcggaacaggaagcattcgaagcaaaagcatgggtagaagctaattaa

DBGET integrated database retrieval system