KEGG   Loa loa (eye worm): LOAG_18724Help
Entry
LOAG_18724        CDS       T02664                                 

Definition
(RefSeq) succinate dehydrogenase flavoprotein subunit
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
loa  Loa loa (eye worm)
Pathway
loa00020  Citrate cycle (TCA cycle)
loa00190  Oxidative phosphorylation
loa01100  Metabolic pathways
loa01200  Carbon metabolism
Module
loa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
loa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
loa_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:loa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LOAG_18724
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    LOAG_18724
Enzymes [BR:loa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     LOAG_18724
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 HI0933_like DAO GIDA FAD_oxidored FAD_binding_3 Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 9947186
NCBI-ProteinID: XP_020304831
LinkDB All DBs
AA seq 646 aa AA seqDB search
MLSVARCLVTKTCHQRAFSLSALRNETKMSSVAEYHIVDHAYDAVVVGAGGAGLRAAMGL
CEGGQKVAVVTKLFPTRSHTVAAQGGVNAALGNMNPDDWRWHFYDTVKGSDWLGDQNAIH
YMTREAVRAVIELENYGMPFSRTEEGKIYQRSFGGQSNNFGKGGMARRTCCVADRTGHSM
LHTLYGSSLQYNCQYFIEYFALDLMMDKGRCVGIIAMNLEDGSMHRFRAKNTVIATGGYG
RAFFSCTSAHTCTGDGTAMIARAGLQNSDMEFVQFHPTGIYGAGCLITEGSRGEGGYLVN
SEGERFMKKYAPNALDLASRDVVSRAITIEIMEGRGVGKNKDHIYLQLHHLPAKDLHAKL
PGIMETAMIFAGVDAAKEPIPVLPTVHYNMGGIPTNYMGQVLTYKPDKGDQLVPGLYACG
ETAAHSVHGANRLGANSLLDLVVFGRACAIDILEKAKKSPEKIPELPKGAGELTIANVDK
LRFARGDIPTAALRLKMQKTMQQHAAVFRRGDILKEGITKMEALFKEQKLLKTTDRGLVW
NSDLAETLELQNLMLNATQTIVAAEARKESRGAHARDDFPTRIDEFDYSKPLDGQTKKPF
DQHWRKHTIIEQNHETGKINLLYRPVIDQTLDKNETDWVQPMIRSY
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgttaagtgtagctcgttgtttggtgacaaaaacatgtcaccaaagagcattttcatta
tcggcgttacgtaatgaaacgaaaatgtctagtgttgcggaatatcatattgttgatcat
gcgtatgatgctgttgtcgttggagctggtggagctggtttacgagctgctatgggtctt
tgcgaaggtggtcaaaaagttgcggtagttacaaaattatttccaacacgatctcatacg
gttgctgctcaaggaggtgttaatgcagctttaggtaacatgaatccggatgattggcga
tggcatttctacgatactgttaaaggaagtgattggttaggagatcagaatgctatacat
tatatgactcgtgaagcagttcgtgctgttattgaattggaaaattatggcatgcctttt
tcacgaacagaagagggtaagatatatcagcgttcatttggtgggcaaagcaacaatttt
ggtaaaggtggcatggctcgtcggacgtgttgcgtagcagaccgtacaggacactcaatg
ctgcatacgctgtatggttcatcacttcaatataattgtcaatatttcatcgaatatttc
gcacttgatcttatgatggataaaggaagatgtgttggcattatcgctatgaaccttgaa
gatggaagcatgcatcgtttccgtgcgaagaacacagtaatcgcaacaggaggatatgga
cgagctttctttagttgtacttctgcacatacgtgcactggtgatggcacggcgatgatt
gctcgagctggactgcagaattccgatatggaatttgttcagtttcatccaaccggtatt
tatggtgcgggttgcctcatcactgaagggtctcgaggcgaaggtggctatttggtgaat
agtgaaggtgaacgcttcatgaagaagtatgcaccgaatgctttagatctggcttcacga
gatgtcgtttcgcgggcgataacgatcgaaatcatggaaggtcgtggtgtcgggaagaat
aaagatcatatttatttgcagctgcaccacttacctgcgaaagatttgcatgccaagttg
ccaggtattatggaaacggcaatgatctttgctggtgtagatgctgcaaaggaaccaata
cccgtcttaccaacggttcattataacatgggcggcataccaacgaattatatgggacaa
gtcttaacgtataaacctgataaaggtgatcagctagtgccgggattatatgcttgtggt
gaaacagcagcacattcggtgcatggtgcgaatcgtctgggagctaattcattgctagat
cttgtcgttttcggacgtgcttgtgctatcgatattctggagaaggctaagaaatcgcct
gagaagattcctgaattaccgaaaggtgcgggagaattaaccattgcaaacgtcgacaag
ttacgctttgccagaggtgatattcctaccgctgctttaagattgaaaatgcaaaagaca
atgcaacagcatgcagctgtattccgacgcggtgacattttgaaggaaggtattacaaag
atggaggctctcttcaaggaacaaaaacttcttaaaacaacagatcgtggattagtgtgg
aattcggatcttgctgagacattagaactacagaatttaatgctaaatgcgacccagact
attgttgctgcggaagctagaaaagaaagtcgtggagcacatgctcgagacgatttcccg
acacgaatagatgagtttgattattcgaaaccgctagatggccaaactaagaaaccattc
gatcagcactggcgtaagcatactatcatcgaacagaatcacgagactggaaagattaat
ttgctttaccgaccggtaatcgaccagacgttggacaagaacgaaacagattgggttcaa
ccgatgatccgatcttattga

DBGET integrated database retrieval system