KEGG   Loa loa (eye worm): LOAG_18725Help
Entry
LOAG_18725        CDS       T02664                                 

Definition
(RefSeq) succinate dehydrogenase
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
loa  Loa loa (eye worm)
Pathway
loa00020  Citrate cycle (TCA cycle)
loa00190  Oxidative phosphorylation
loa01100  Metabolic pathways
loa01200  Carbon metabolism
Module
loa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
loa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
loa_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:loa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LOAG_18725
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    LOAG_18725
Enzymes [BR:loa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     LOAG_18725
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C
Motif
Other DBs
NCBI-GeneID: 9950080
NCBI-ProteinID: XP_020304832
LinkDB All DBs
AA seq 607 aa AA seqDB search
MKNSFVCVLGGAGLRAASRLGEGGLRVAVITKLFPTRSHTVAAQGGINAAIGSMNPDNWK
WHFYDTVKGSDWLGDQNAIHYLTKDAIRAVIELENYGMPFSRTAEGKIYQRSFGGQSNNY
GKGGVAKRTCAVADRTGHSMLHTLYGASLQFHCNYYIEFFALDLLMHEGRCIGVIAMNLE
DGTIHRFRAPFTVLATGGFGRAYFSCTTAHSTTGDGNAMVIRAGLQTTDMEFIQFHPTGI
YGVGCLITEGSRGEGGYLVNNKGERFMAKYAPKALDLASRDVVSRAMTIEIIEGRGVGKE
NDHIYLQLHHIPADHLHNKLPGIMETAKIFAGVDATKEPIPVIPTVHYNMGGIPTDYKGQ
VITFSSSKGDQLVPGLFACGETAAHSVHGANRLGANSLLDTVVFGRACANNILEQAKSTN
SKIPDLPLDAGEATLANLDKMRFAKGDIYTGALRLKMQKTMQKHAAVFRRGDILQEGIKQ
MEIIYGEQKHLKTADRGLIWNSDLIETLELQNLLLCAMQTIVAAEAREESRGAHARDDFK
QRVDEFDYSMPLAGQIKNHLNNIGVNIQSLIKIRKPEKFVSLSYRPVIDQTLDENEVETI
PPIIRKY
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatagttttgtttgcgttttaggtggagcaggtttacgtgcagcatcacgtctt
ggtgaaggtggcttacgagtagctgtaataacgaaattatttccaacaagatcacatact
gtagctgcacaaggaggtattaatgcagcaattggtagtatgaatccggataattggaaa
tggcatttttatgatactgtaaaaggaagtgattggttgggtgatcaaaatgcaatacat
tatctgacaaaagatgctattcgagcggtaattgaacttgaaaattatggaatgccattc
tcgagaacagctgaagggaaaatttatcaacgttcatttggtgggcaaagtaataattat
ggcaaaggtggagttgctaagcgtacatgcgctgtagctgatcgtacaggtcattcgatg
cttcatacactttatggtgcatcattacaatttcattgcaattattatatcgaatttttt
gctcttgatcttcttatgcatgaaggaagatgtattggagtgattgcaatgaatcttgaa
gatggaacaattcatcgttttcgagcaccatttactgtattagcaacaggtggatttggt
cgagcatactttagttgtactacagcacatagtaccactggtgatggtaatgcaatggta
attcgtgctggtttacaaacaactgatatggaatttatccaatttcatccaactggtatt
tatggtgttggttgtctgattacagaaggatcacgaggagaaggtggttatttagtaaat
aataaaggtgaacgattcatggcaaaatatgctccaaaagcattagatttagcatctcga
gatgttgtatccagagcaatgaccattgaaataatcgaaggtcgtggagttggtaaagaa
aatgaccatatatacttgcaacttcatcatattcctgcggatcatttacataataaatta
ccaggaataatggaaacggctaaaatttttgccggtgttgatgcgactaaagagccaata
cctgtaattccaacagttcattataatatgggtggaataccaactgattataaaggacaa
gtaataaccttttcaagtagtaaaggtgatcaattagtaccgggattatttgcatgtggt
gagacagcggcgcattcagtacatggggcaaatcgacttggcgctaattctcttcttgat
actgttgtatttggacgtgcttgcgctaataacatattggaacaagcaaaatcaaccaat
tctaaaattccggatttaccgcttgatgcgggcgaagctacgcttgctaacctggataag
atgcgctttgcaaaaggtgacatttatactggtgctttacgattaaaaatgcaaaaaaca
atgcaaaaacatgcggctgtctttcgacgtggcgatattttacaggaaggtatcaaacaa
atggaaattatctatggtgaacaaaaacatctgaaaactgctgatcgtggattaatttgg
aattcggatctaattgaaacattagagttgcaaaatttattactttgtgctatgcaaacg
atcgttgcagcagaagctcgggaagaatctagaggagctcatgctcgggatgattttaag
caacgagtcgatgaatttgattattccatgccattagcaggacaaataaaaaaccacttg
aacaacattggcgtaaacatacaatcattaatcaaaatccggaaaccggaaaagtttgtt
tcattgagttatcgaccagtaatcgatcaaacattggatgagaatgaagtggaaactata
ccgccaataattcgaaaatactaa

DBGET integrated database retrieval system