KEGG   Legionella oakridgensis: Loa_00100Help
Entry
Loa_00100         CDS       T03928                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
lok  Legionella oakridgensis
Brite
Enzymes [BR:lok01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Loa_00100 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N PHA_synth_III_E TGF_beta_GS
Motif
Other DBs
NCBI-ProteinID: AHE65691
UniProt: W0BAG7
LinkDB All DBs
Position
complement(89214..89792)
Genome map
AA seq 192 aa AA seqDB search
MTFTLPSLPYAKNALAPHISEETLEYHYGKHHQTYVNNLNKLVENTEFAAKSLEDIIKKS
SGGLFNNAAQVWNHTFYWHCMSPNGGGEPSGKLADAINKAFGSFAKFKEQFTNTAATTFG
SGWAWLVQDSDAHLKIISTSNAGTPMTQGLNAILTCDVWEHAYYIDYRNARPDYISAFWK
LVNWEFASDNLK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgacgtttaccttgccctcattaccttatgcaaaaaatgccctggcaccgcatatttct
gaagaaacactggaatatcattacggcaaacatcatcaaacttacgtcaataatctaaat
aaattggttgaaaataccgaatttgctgcaaaaagccttgaagatatcataaaaaaatct
tcaggcggtctgtttaataatgcagcgcaagtatggaatcataccttttattggcattgt
atgtctccaaatggcggtggcgagccttcaggaaaactggcagacgccattaataaagca
tttgggtcttttgccaaatttaaagaacaatttaccaataccgctgcaaccacctttggt
tcaggctgggcttggttagtgcaagacagtgatgctcacttaaaaattatcagtaccagt
aatgccgggacccccatgactcaaggcttgaatgccattttgacttgcgatgtctgggaa
catgcctattacattgattatcgtaatgctcggccagattatatcagcgccttttggaag
ttggtcaattgggaatttgcatccgataatttgaaataa

DBGET integrated database retrieval system