KEGG   Legionella oakridgensis: Loa_01084Help
Entry
Loa_01084         CDS       T03928                                 

Definition
(GenBank) collagen triple helix repeat protein
Organism
lok  Legionella oakridgensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Collagen DUF1566
Motif
Other DBs
NCBI-ProteinID: AHE66640
UniProt: W0B9V0
LinkDB All DBs
Position
988810..989829
Genome map
AA seq 339 aa AA seqDB search
MIKQCIHALFLVCVLIGTSTAYAANPATREYVDAQVTILRSQIMAIPAGKQGPVGPQGEQ
GSQGEQGPQGEQGPQGEQGPQGEQGPQGEQGPQGEQGPQGEPGPQGEQGPQGEQGPQGEQ
GPQGEQGPQGEQGPQGEQGPQGEQGPQGEEGPQGEQGPQGEQGPQGEQGPQGEPGPQGPA
GADGVGGVTTAGDNISVTGAGTVNDPYVVTNIARRVGEQQDGGIIFFVDGTGQSGLVAAT
TDEPGTYTWYGAISQCQNKDSGGGWFLPKKSQLTLLWTNRYALDPNSNNGGFDVSIYWSS
TEFDEDYAWGQDFNSGIQGYLSNDFEKFANNLVRCIRVF
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgattaaacaatgcattcatgctctatttttagtctgtgttttaataggcacaagcaca
gcctatgctgctaatccggctacaagagaatatgtagacgctcaagttactatattgcga
tcacaaattatggctattcctgctgggaaacaaggtcccgtaggtcctcaaggtgaacag
ggttctcaaggtgaacagggccctcaaggtgaacaaggccctcaaggtgaacagggccct
caaggtgaacagggccctcaaggtgaacagggccctcaaggtgaacagggccctcaaggt
gaaccgggccctcaaggtgaacagggccctcaaggtgaacagggccctcaaggtgaacag
ggtcctcaaggtgaacagggccctcaaggtgaacagggccctcaaggtgaacagggccct
caaggtgaacagggccctcaaggtgaagagggtcctcaaggtgaacagggtcctcaaggt
gaacagggtcctcaaggtgaacagggtcctcaaggtgaaccgggtcctcaaggtccagct
ggtgctgatggtgtcggaggcgttacgacggcaggcgataatatttctgtaactggagca
ggtacggtaaatgatccttacgttgtgaccaacattgctcgtcgcgttggtgaacaacaa
gatggcggaataattttctttgttgatggcaccggccagtctgggttagttgcagcaaca
acagatgagccaggtacctatacttggtatggcgctattagccaatgtcaaaataaagat
agtggaggaggttggtttttacccaaaaagtcccagttgactttgctgtggactaatcgc
tatgcattagatcctaattctaataatggcggttttgacgttagcatctattggagttct
actgagtttgatgaggattacgcgtggggtcaggactttaatagtggtattcagggttat
ttgtcgaacgatttcgaaaagttcgccaacaatctggttagatgtattcgggttttttaa

DBGET integrated database retrieval system