KEGG   Legionella oakridgensis: Loa_01107Help
Entry
Loa_01107         CDS       T03928                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
lok  Legionella oakridgensis
Pathway
lok00550  Peptidoglycan biosynthesis
lok01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:lok00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Loa_01107
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Loa_01107
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lok01011]
    Loa_01107
Enzymes [BR:lok01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Loa_01107
Peptidoglycan biosynthesis and degradation proteins [BR:lok01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   Loa_01107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AHE66663
UniProt: W0B7Z2
LinkDB All DBs
Position
complement(1008600..1010450)
Genome map
AA seq 616 aa AA seqDB search
MRLNDSVKNDRQELQVHHFRLSLLVALLVILSFILILRLAYLQFSQFKRYATLSLKNQMS
IIPIAPPRGIILDKNGVILADNIPVYVLEIIPERVTNLTATLAKLKQLIPSITDEDIDNF
NHARSQNRSYVPIPLKLKLTEEEVAIFASNQYLFPGISIKARLMRYYPLGAPVAHLLGYV
GRINVQELQQVDNTNYRATNFIGKSGIERYYENTLHGRVGYQQVETDVSGRTLRVLSKQA
PVSGAKIYLTIDARLQEAVYNALEGKRGAAVVMSVKDGDILAMVSTPSFDPNLFVNGISN
KDYQQLANTQDKPLYNRAVRGLYPPASTVKPFVALAGLEKGTITPSTKIYDPGWYGLPGV
SHKYRDWKRHGHGIINLKRAITVSCDTYFYQLGNKLGISAIEDFLMQFGFGQLSHVDLFE
EAPGIVPGPSWKRRSRGASWYPGDTLITSIGQGFMLASPLQLANATAALSMHGRRFRPHL
FGRSVEDDGKVHPYKPLEEYPIQLKDNVHWTIITEAMQNVINSPEGTGHRFGRNSAYTVA
GKTGTAQVFSGNQYEKKSYQEIPEALRDHSLFIAFAPVENPEIAVSVLVENDFIASIVAR
KIMDAYFDLNQKNPET
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttaaatgactctgttaaaaatgatcgtcaggaattgcaggtacaccacttccgc
ttaagcttgctggtagcactgttggtcatattatcttttattttgattttacgcttagct
tatttgcaattttctcaatttaaacgctacgctacgttatccttgaaaaatcaaatgagc
atcattcctatcgctccaccgagagggattattcttgataaaaatggagtcattcttgcc
gataatattcctgtgtatgtgcttgaaattatcccagagcgggtaactaatttaacagca
accctggcgaaattaaaacaattaattccctctattaccgatgaagacattgacaatttt
aatcatgctcgcagccaaaaccgttcctacgttccaattcctttaaaactcaaattaacg
gaagaagaagtcgcgatttttgccagtaatcagtatttgtttccaggaatcagcattaaa
gcaaggctgatgcgttattatcctctgggagcaccggtcgcgcacttgcttggctatgtt
gggcggattaatgtccaggaattgcagcaagtcgataataccaactatcgtgccactaat
tttatcggcaaatcaggcattgaacgttattatgaaaacaccctacatggtcgggtaggt
tatcaacaggtagaaacggacgtcagtggcagaacattgcgcgttttaagtaaacaagcc
ccagtatccggtgcaaaaatttatcttaccattgatgcccgtctgcaagaggctgtttat
aacgcgctggaaggcaaacgcggtgcagccgtggttatgagtgtcaaagatggtgacatt
ttagccatggtaagtacccctagttttgatcccaatttatttgtgaatggcatcagtaat
aaagattatcagcaattggctaatactcaagataagcccttgtataaccgcgctgtccgt
ggcctttatccgcccgcatcaaccgttaagccattcgttgctttggccggacttgaaaaa
ggcaccattacccccagtaccaaaatctacgatccgggctggtatggccttcccggagtc
agtcataaataccgtgactggaagcgccacgggcatggcatcattaatcttaaacgagcc
attactgtctcttgcgatacctatttttatcagctgggcaataagcttggcatttcggcc
attgaagactttttaatgcaatttggcttcggacaattatctcatgtggatttgtttgaa
gaagcaccgggcattgttcctggcccaagctggaaacgaagaagccgcggcgcatcctgg
tatcctggcgatacattaatcacttccataggacaaggctttatgttagcttcccccttg
caattagctaatgcaactgccgcattaagcatgcatggccggcgatttcgtccccatctg
tttggccgttcggttgaagacgatggtaaagttcatccatataaacccttggaagaatat
ccaatccaattaaaagataatgttcactggactattattacagaagccatgcagaatgtt
attaacagcccggaaggaactgggcatcgttttggccgtaattcagcttatacggtggca
ggaaaaaccggaacagctcaagtattcagtggcaatcaatatgagaaaaaaagctatcaa
gagattcctgaagcactgcgtgatcattcactattcattgcttttgctcccgtggaaaat
cccgaaatcgctgtctctgtgctggtagaaaatgattttatcgcgtccatcgttgctcgc
aaaatcatggatgcttactttgatttaaaccaaaagaatcctgaaacatga

DBGET integrated database retrieval system