KEGG   Legionella oakridgensis: Loa_01150Help
Entry
Loa_01150         CDS       T03928                                 

Definition
(GenBank) penicillin-binding protein, 1A family
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
lok  Legionella oakridgensis
Pathway
lok00550  Peptidoglycan biosynthesis
lok01100  Metabolic pathways
lok01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:lok00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Loa_01150
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Loa_01150
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:lok01003]
    Loa_01150
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lok01011]
    Loa_01150
Enzymes [BR:lok01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     Loa_01150
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Loa_01150
Glycosyltransferases [BR:lok01003]
 Polysaccharide
  Bacterial polysaccharide
   Loa_01150
Peptidoglycan biosynthesis and degradation proteins [BR:lok01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   Loa_01150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: AHE66706
UniProt: W0BDD8
LinkDB All DBs
Position
complement(1048384..1050501)
Genome map
AA seq 705 aa AA seqDB search
MCISLLYLYLESQLPNVDSLKSVQLQVPLRIYTQDGLLIQEYGEKKRIPLSYDEIPQTLV
HAVLATEDQRFFDHPGVDIFGLGRAAIRMIKTGTKSQGGSTITMQVARNFFLNRKKTFLR
KFNEILLAIKIDKELSKEKILELYLNKIYLGNRAYGVGAAAQVYYGKPLKELNLAQLAMI
AGLPQAPSTQNPIINPLAAKKRRDHVLERLLEEKYITEEQYHDAINQPITARYHGSKVEV
NAPYVAEMIRQSLYDHFGPDAYTKGYKVYTTITGSLQIVANQVVEENLLAYDRRHGYRGP
VANIGEVDPSSIDQLHALLTQYPVINDLEPAVILTVSEQEATATSRRGQSFTIPWQGLSW
ARPALKKGWVGKSPTQAKQVVSAGDIVYVRYHNDMWQLSQIPQVESALVALNPQNGAIQA
LVGGFNFERSKFNRATQSGRQPGSSFKPFIYAAALNKGYTLATLVNDAPIVIDDPSQANL
WRPHNDNRKFNGPTRLKEGLVRSRNMVSIRILDDIGIDYAIDFITHFGFHRENLPHALSL
ALGSLSVSPMDLTAAYAIFANGGFKVEPFLIDHITDNEGKILLQAKPLIACTEPCADKNI
DPDIMAPRVIPEDIAFLMNSALKGVIQQGTARAATILNRQDLAGKTGTTNDQVDAWFAGY
YPELVVTTWVGYDTPHSLHEYAAALALPVWIDFMKAALKINLNSS
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
gtgtgcataagcttgctttacctttacctggaaagccagctacctaatgtagactcctta
aaatcagtgcaattgcaagttcctttgcgaatttatactcaagatggtttattaattcag
gagtatggagagaaaaaacggattcctctcagttatgacgaaatcccccaaacactggtt
catgcggtacttgctacggaagatcagcgcttttttgaccatccgggtgttgatattttt
ggactgggacgtgcagccatacgcatgattaaaaccggaaccaaatcccagggcggaagt
actattaccatgcaggtcgcccgcaattttttcttaaatcgcaaaaaaactttcctgcga
aaatttaatgaaattcttcttgccatcaaaattgacaaggaattaagcaaggaaaaaatt
cttgaactgtacctgaataaaatttacttaggcaatcgggcttatggggttggcgctgca
gcccaagtgtactatggcaagcctttaaaagagcttaatcttgcccaattagcgatgatt
gccggcttgccacaagctccttctacccaaaaccccatcattaatcctctggcggcaaaa
aaacgtcgtgatcatgtcttagaacgattgcttgaagaaaaatacattaccgaagaacaa
taccacgatgccattaaccagcctattacggccagataccatggttctaaagtggaagtc
aatgcgccttatgtcgccgaaatgattcgccaatcattgtatgatcattttggaccagat
gcttatacaaagggttataaagtctatacgacgattacaggatcattgcaaatcgttgca
aatcaggttgttgaagaaaatttgctagcctatgatcggcgacacggttaccgaggacct
gttgccaatattggcgaggttgatccatcctccattgatcaactgcatgcattgcttact
caatatccggtcatcaatgatttggaacccgctgttattctaacggttagcgaacaagag
gcaacggccacctcccggcgcgggcaatcttttaccatcccttggcaaggcctttcatgg
gcaagacccgctcttaaaaaaggatgggtaggaaaatcgccgactcaagcaaaacaagtg
gtatctgcaggagatattgtttacgtccgttatcataacgacatgtggcaattaagccag
attccacaagttgaaagtgcattggttgctttaaacccgcaaaacggtgctatccaggct
ctggtgggtggatttaattttgaaagaagtaagtttaatcgtgccactcaatcaggcaga
cagccaggctccagtttcaaaccttttatttacgctgcagccctgaataaagggtatacg
ttggcaacattagtcaatgatgcacctattgttattgatgatcccagccaagccaactta
tggcgtcctcataatgataaccgcaaatttaatggtccaacacgtctaaaagaagggttg
gttcgttctcgcaatatggtatccattcgtattttagatgacattggcattgattatgca
attgattttattactcactttggctttcatagagaaaatttgccgcatgctttatctctg
gctttgggcagtttgtctgtaagcccaatggatcttaccgctgcatacgccatatttgcc
aatggtggcttcaaggtagagccatttctcattgaccatatcacagataatgaaggtaaa
attctgttgcaggccaagccattaattgcctgcactgagccatgcgccgataaaaacatc
gatccggatataatggcaccacgtgttataccagaagacattgcctttttaatgaatagc
gccttaaaaggtgtcattcagcaaggtacagcgcgtgctgcaaccatattgaatcgccag
gatttggctggtaaaactggaacaacgaacgatcaagtcgatgcctggtttgcgggttat
tatcccgaacttgtggttactacctgggtaggatatgacaccccacattccttgcatgaa
tacgccgctgccctggctttgcctgtatggattgattttatgaaagcagccctaaaaata
aacctgaactcgagctaa

DBGET integrated database retrieval system