KEGG   Legionella oakridgensis: Loa_01180Help
Entry
Loa_01180         CDS       T03928                                 

Definition
(GenBank) putative amidohydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
lok  Legionella oakridgensis
Brite
KEGG Orthology (KO) [BR:lok00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Loa_01180
Enzymes [BR:lok01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     Loa_01180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AHE66735
UniProt: W0BA54
LinkDB All DBs
Position
1076776..1077579
Genome map
AA seq 267 aa AA seqDB search
MSRVAVIQMVSSANVKNNLNQLSEWFADARDEGAKLLVLPENFAFMGMNEKDKFQVAEDY
GQGEIQQKIGTLARQYQLWVIAGTMLLKTQGNRLRSGCLVYDDKGIVVARYDKIHLFDVR
VSEQEAHQESLTIEPGSDVVVVDTPIGRVGLSVCYDLRFAELYQQLVMKGAELFTVPSAF
TAITGKAHWEVLLRARAIENLCYVLAANQGGLHENGRNTYGHSMIIDPWGRILSRRRQGT
GMIVAEIDLQQLHHMRQEFPCLDHHVL
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgtgttgcggtgattcaaatggtttcatcagccaacgtcaaaaacaatctgaat
caactttccgaatggtttgctgatgctcgagatgaaggagccaaattgctggttttacct
gaaaattttgcatttatggggatgaatgaaaaagataaatttcaggttgcggaagactat
ggacaaggtgaaatacaacaaaaaattggcacacttgctaggcaatatcagctatgggtt
attgctggcacgatgttattgaaaacgcaaggaaatcgcttgcgatcagggtgtttggtt
tatgatgacaagggcattgttgttgcacgttatgataaaattcatttatttgatgtgcgg
gtatccgaacaggaggcgcatcaagaatccttaaccattgaaccaggtagcgacgttgtt
gtggtcgacactccaatagggcgagtagggttgagtgtttgttatgatttgcgttttgcg
gaattataccaacaattagtaatgaaaggggctgagctttttacagtaccatcagcgttc
acggcaatcactggcaaggcacattgggaggtgttactcagagcgcgtgctattgaaaat
ttatgttacgttcttgcagcgaatcagggtggattgcatgaaaatggccgaaacacttat
gggcatagcatgattattgacccttggggacgtattttaagcaggcggcggcaggggaca
ggaatgattgtggcggagattgatttacaacaattacatcatatgcgtcaggagtttcct
tgccttgatcaccatgtattataa

DBGET integrated database retrieval system