KEGG   Lokiarchaeum sp. GC14_75: Lokiarch_31830Help
Entry
Lokiarch_31830    CDS       T04015                                 

Definition
(GenBank) small GTP-binding domain protein
Organism
loki  Lokiarchaeum sp. GC14_75
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf MMR_HSR1 FeoB_N Gtr1_RagA AAA_16 TniB SRPRB
Motif
Other DBs
NCBI-ProteinID: KKK42847
UniProt: A0A0F8VES5
LinkDB All DBs
AA seq 179 aa AA seqDB search
MGKKNIILKIALLGDPAVGKTSLINRFTEESFKDDYQPTLGVNIIMKKLKLDDFNVQLAI
WDIAGQDKYELTRRLFFEGCSGALLVYDLTRSSTIDHIKNKWVIDFSKFARPDGMYILIG
NKGDLKDSITISSEKGREIAKEITASDFIETSAKSGDNVERAFEGLVTQILKNFNFKRK
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaaaaaacattattcttaaaatagctttattaggtgaccccgcagtaggaaaa
acatctcttattaatagatttactgaagaatcttttaaagacgactaccagcctactttg
ggtgttaatataataatgaaaaagttaaagcttgacgattttaatgtacaacttgctatt
tgggatattgctggtcaggataaatatgaattaactaggagattatttttcgaaggttgc
tccggagcgctattagtttatgatctcacaagaagctctacaattgaccatattaaaaat
aagtgggtaatagatttcagtaaatttgctagacccgatggtatgtatatattaattggg
aataagggtgatttaaaagactctattacaatttcctcagagaaggggagagaaattgct
aaagaaattacagcaagtgatttcatagagacgagtgctaaatctggtgataatgtggaa
agagctttcgaaggattagttacacagatcttaaagaattttaacttcaaaaggaaatga

DBGET integrated database retrieval system