KEGG   Lactobacillus oris: AYI71_00260Help
Entry
AYI71_00260       CDS       T04391                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lor  Lactobacillus oris
Pathway
lor00473  D-Alanine metabolism
lor00550  Peptidoglycan biosynthesis
lor01100  Metabolic pathways
lor01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lor00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AYI71_00260
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AYI71_00260
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AYI71_00260
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lor01011]
    AYI71_00260
Enzymes [BR:lor01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AYI71_00260
Peptidoglycan biosynthesis and degradation proteins [BR:lor01011]
 Precursor biosynthesis
  Amino acid ligase
   AYI71_00260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AMS07379
UniProt: A0A142KMP1
LinkDB All DBs
Position
complement(57639..58772)
Genome map
AA seq 377 aa AA seqDB search
MTKKLRVALLFGGNSSEHDVSKRSAHNIYDAMDKDKYDVSLFMFTKDGILLDNAYSQRIF
DGEPEDQVVADAYRHMDLDQPLAPIMALNELEAVDFFYPVIHGNLGEDGTIQGLFKLLKK
PYVGSGISASALSFDKDLTKKMLNEAGIRNTPYVLLTPENQAEYSWGRLEEELGNLIFIK
PARQGSSVGIHRVTNAEEYAAALKDAFKYDFKVLAEKGLDRPQEIEISILGNEHPVASKL
GAVRVPESDPFYDYENKFVDASGVVFELPVKLPQYLTDEITEMALKAYRVLGMKGLSRID
FLVDSNNIPYLSEPNTLPGFTNISLYPQMWEVSGISYSELIDRLIELGLAEFKRNSQIKY
DFRELGTEHVGQKKYND
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagaaattacgtgttgctttattgtttggtggcaattcatctgaacatgatgtt
tctaaacggtcagcacataatatttatgatgccatggacaaggacaagtatgatgtcagc
ctttttatgttcactaaggatggcatcctgctggataatgcctactctcaacgaatcttt
gatggggaacccgaagaccaggtggtagcggatgcttaccggcacatggacctcgaccag
ccgctggccccaattatggcgctgaacgagctggaagcggtcgacttcttctacccggtt
attcacgggaatctgggggaagatgggacaatccagggtctgttcaaactgctgaagaag
ccttacgtcgggtccggaatttctgccagtgccctttcctttgacaaggacctgaccaag
aagatgttaaacgaggctggaatcaggaataccccgtacgtcctgctgacaccggaaaat
caggccgaatattcctggggacggttagaggaagaactcggcaacctgatctttatcaag
ccagctcggcaaggatcgtcggtggggattcaccgggtaacgaacgctgaggagtacgcc
gcggcgcttaaagatgccttcaagtatgactttaaggttttggcagagaaggggcttgac
cggccgcaggaaattgaaatttctattttaggcaatgagcacccggtagcttctaagctg
ggggccgttcgggtaccggaaagcgatcctttctatgactacgaaaacaagtttgtcgat
gccagcggcgtggtctttgaactgccggtgaagttaccgcagtacttgactgacgaaatt
acggagatggcgttgaaggcgtaccgggttctggggatgaagggactctcacggattgac
ttcctggttgattctaacaacattccatacctgagcgagccgaacaccctgcctggcttt
accaacatcagcctctacccgcagatgtgggaagtttctggcatttcgtattcagaactg
attgaccgcctgattgaacttggtttagcagagtttaaacgaaacagtcaaattaaatat
gatttccgtgaattaggaacggagcatgttggtcaaaagaaatacaacgactaa

DBGET integrated database retrieval system