KEGG   Lactobacillus oris: AYI71_05040Help
Entry
AYI71_05040       CDS       T04391                                 

Definition
(GenBank) MFS transporter
Organism
lor  Lactobacillus oris
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_1_like DUF2339 BTP
Motif
Other DBs
NCBI-ProteinID: AMS08208
UniProt: A0A142KQ20
LinkDB All DBs
Position
complement(1026253..1027437)
Genome map
AA seq 394 aa AA seqDB search
MTKQRQVKLKWVALASLLNNTGPAFLWPLTTMYMHNYLHESLTTAGVVMLLMSICMMVGN
YLGGWLFDHWDQYQTAVLGVTISTVAIFTLIFAHGWPWFAVLMMLNNLGDGINMTIVNSY
GSLVSDHSSRYVFNYIYMAFNVGVVIGTLAVGVLLPVSVVLVFTVATVFYFLLALVVVFA
LKVRVPLPPKTPRSREKLASRSHQQALVLIWLILLNFVTIHLSYSLWESVMAVHMTNMGI
PFYAYSLLWTLNGVLIIVGQPLVNKLSPYVRLSSQIIVGILIFASSFILLIFARNLWAFV
LDFVLLTIGEMASFAGLPAWIAQLTTVNEAGHYQGLLNIMMSIGRAIGPLYGGFVIDHGN
YQELFISVFLLMTVTLGGVFAYLLRLRRLSDDSK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagcagaggcaggttaagttaaaatgggtagccctcgcaagtttgcttaacaac
actgggcctgcttttttgtggccgttgacaacgatgtatatgcacaactacctccacgaa
agtctgacgacggcaggggtagtaatgcttttgatgtcaatctgcatgatggtcggcaac
tacctgggtgggtggttgtttgaccactgggaccagtaccagacggcggtcttaggggta
acaatctcaacggtggcgatctttaccctgatctttgcgcacggctggccgtggttcgcg
gtcctgatgatgctgaacaacctgggggatggtattaacatgaccatcgttaattcatac
ggctccctggtcagtgatcacagttcgcgctacgtctttaactatatttacatggccttc
aatgtcggggtcgtaattggcacgttggcggtgggggttctcctgccagtcagcgtcgtg
ctggtctttacggttgccactgtcttttacttcctgctggccctggtggtcgtgtttgcc
ctcaaagtccgggtcccgttaccgccgaaaacaccacggtcccgggagaagttagcctct
aggagccaccagcaagccctcgtgttaatttggctgatcctcctaaactttgtaacgatc
cacctcagctactcactctgggagagcgtaatggctgtgcacatgacgaatatgggaatt
cccttttacgcgtacagcctcctgtggacgctcaacggggtgctgattatcgtcggccag
ccattggtgaacaagctcagcccctatgttcgtttatccagccagattatagtcggtatt
ctgatttttgccagttccttcatcctcttgatctttgctcggaatctgtgggccttcgtg
cttgattttgttctcttgacgattggcgaaatggccagtttcgcggggctgccggcttgg
atcgcccagttgacaacggtgaacgaggctgggcactaccagggactgctcaacatcatg
atgtcgattgggcgggcaatcgggcccctttatggcggttttgtgattgaccatgggaac
taccaagagctctttatttctgtcttcctgctgatgacggtcacccttggtggggtcttt
gcctacctgctacggctgcgccggctcagcgacgacagcaaatag

DBGET integrated database retrieval system