KEGG   Lactobacillus oris: AYI71_07635Help
Entry
AYI71_07635       CDS       T04391                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
lor  Lactobacillus oris
Pathway
lor00061  Fatty acid biosynthesis
lor00780  Biotin metabolism
lor01100  Metabolic pathways
lor01130  Biosynthesis of antibiotics
lor01212  Fatty acid metabolism
Module
lor_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:lor00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AYI71_07635
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AYI71_07635
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    AYI71_07635
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:lor01004]
    AYI71_07635
Enzymes [BR:lor01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     AYI71_07635
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     AYI71_07635
Lipid biosynthesis proteins [BR:lor01004]
 Fatty acid synthase
  Component type
   AYI71_07635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Enoyl_reductase ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: AMS08661
UniProt: A0A142KRC3
LinkDB All DBs
Position
complement(1526748..1527512)
Genome map
AA seq 254 aa AA seqDB search
MEGLLANKTIVVMGVANRRSIAWGCAQEMEKQGATVIYTYNRERTLKRLTKLVGEEKADR
MIQCDVASDESIQRAFQQIGEQFGQLDGVVHSVAFANPAELGGEMTDVSREGYALAQDVS
AYSLIAVCRAAAPLLKNPASVVTMSYFGAERAIPNYNVMGVAKAALEANVRYLARDMGKN
GVRVNAISAGALKTLAVTGIQGHGELLAMSKARAVDGKDVTIEEVGGTATFLMSDLSTGV
TGDVIYVDKGVHLI
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggaaggattattagcgaacaagacgattgtggtgatgggggttgccaaccgtcgttcg
attgcttggggttgtgcccaggaaatggaaaagcaaggggctacggtaatttacacctac
aaccgggaacggaccttaaagcgcctgactaagctggtgggcgaagaaaaggccgaccgg
atgattcaatgtgacgtggccagtgatgaaagcattcaacgggcctttcaacagattggc
gaacaattcggccaactggacggggtggttcattccgttgcctttgccaacccggctgaa
ctaggtggggaaatgaccgatgtttcacgcgagggttacgccctggcccaagacgtttcg
gcctactccttaatcgccgtatgccgggccgcagccccgttgctaaagaacccagctagc
gtggtcacgatgtcgtactttggggccgaacgggcgatccctaactataacgtgatgggg
gtagccaaggcggctctagaggccaacgtccgctatttagcgcgtgacatgggtaaaaac
ggggtgcgggtcaacgccatttcggctggcgccctgaagaccttagcggtgacgggaatt
caaggacatggtgaattattggccatgtcgaaggcccgggccgtcgatggcaaggatgtt
acgatcgaagaggtgggcggcaccgccaccttcttaatgagcgatctgtccaccggggtg
accggtgacgtaatttacgttgacaaaggtgtccacttaatttaa

DBGET integrated database retrieval system