KEGG   Leptotrichia sp. oral taxon 847: AXF11_06715Help
Entry
AXF11_06715       CDS       T04653                                 

Definition
(GenBank) hypothetical protein
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
lot  Leptotrichia sp. oral taxon 847
Brite
KEGG Orthology (KO) [BR:lot00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AXF11_06715
Enzymes [BR:lot01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AXF11_06715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 HI0933_like DAO K_oxygenase FAD_oxidored Thi4 Lycopene_cycl AlaDh_PNT_C 3HCDH_N NAD_binding_8 FMO-like CLP1_N FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AMD95290
UniProt: A0A0X8JUU6
LinkDB All DBs
Position
1446853..1447836
Genome map
AA seq 327 aa AA seqDB search
MDFSLNLGVLDEGKLQKIDENKLYDVTVIGAGPAAVSSAIYAARKGLDVAMVGVKVGGQV
LDTNEIENIIGTISTTGSKFAETLHNHLKEYAIAFKEGHVVKEISLDGKDKVFVTDDGKK
YKTKAIILATGAKPRSLNIPGEAEYVGKGVHYCSTCDGPFYKGLDVAVIGGGNSGVEAAL
DMSGIAKNVTLIEFMPELKADKVLQKKLAQRENVNVILNSATTEVLGTEFVENLKYKNRA
TDEEKTLKLDGIFIEVGLSPSSEIVKDLVELNKVGEIVINPVNNETSVEGIFAAGDVTNI
KQKQIIVAMGEGAKAALSAFDYLIAKY
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggactttagtttaaatttaggtgttttggatgaaggaaaactacaaaaaattgacgaa
aataaactttatgatgtaactgtgattggagcgggaccagcggcggtttctagtgcaatt
tatgcggctcgtaaaggtttagatgttgcaatggtcggagtaaaagtgggtggacaagtt
ttggacacaaatgaaattgaaaatataataggaacaatttctacaactggaagcaaattt
gccgaaactttgcacaatcatttaaaggagtatgcaattgcgtttaaagaagggcatgtt
gtaaaagaaatttcgcttgatggaaaagataaagtttttgtaactgatgacgggaaaaaa
tataagacaaaagctataattttagcaactggtgcaaaacctagaagtcttaatattcct
ggagaagctgaatatgttggaaaaggagtgcattactgttcaacttgcgatgggcctttt
tacaaaggacttgatgtcgctgtaatcggcggtggaaactcaggcgtggaagctgcgctt
gatatgtcaggaattgcaaaaaatgtcactttaattgaatttatgccagaattgaaagcc
gacaaagttttacagaaaaaattggcacagcgtgaaaacgtgaatgtaattttaaattca
gcaactacggaagttttaggaacagaatttgtggaaaatttaaaatataaaaatcgggct
acagacgaagaaaaaactctaaaattggacggaatatttatcgaagtcggactttctcca
agcagtgaaattgtaaaagatttagttgaattgaataaagtgggggaaattgtaataaat
ccagtaaataatgaaacttcagtggaaggaatctttgccgcaggagatgttacaaacata
aaacaaaaacaaataattgttgcaatgggagaaggtgcaaaagcagcacttagcgcattt
gattatttaatcgcaaaatattaa

DBGET integrated database retrieval system