KEGG   Leptotrichia sp. oral taxon 847: AXF11_07755Help
Entry
AXF11_07755       CDS       T04653                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
lot  Leptotrichia sp. oral taxon 847
Pathway
lot00500  Starch and sucrose metabolism
lot01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AXF11_07755
Enzymes [BR:lot01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AXF11_07755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: AMD95478
UniProt: A0A109W7Q0
LinkDB All DBs
Position
1658428..1659876
Genome map
AA seq 482 aa AA seqDB search
MLNGVMIQYFEWNLADDGKHWERLKNDAAHLKEIGVSAVWIPPAYKGTFSGDVGYGAYDL
WDLGEFNQKGTVRTKYGTKEELIDAINELHKYGINVYLDAVLNHKGGADETERFSVIEVD
PENRNEEISEPKEIEGWTKFTFPGRNKKYSEFEWNHTLFSGVDYDNLTGKNAIYKIVGEN
KGWAENVDSELGNYDYLMNADVDYSHPEVRNEIINWGKWVVNELNLDGFRMDAVKHISGD
FIKEFLIEVRKVYGEEFYSVGEYWKDDLDTLKTYLENIGYETDLFDVGLHFNFHKASVEK
ENYDLTTILDNSVMLMDPIKAVTFVDNHDSQKGSALESEIESWFIPHAYAIILLSEKGYP
CLFYGDYYGVGNNKSPHGWVIDKLLYVRRNNAYGEQINYFDDPNIIAFYRKGRENEINTG
CVAVLSNNEAGEKVIEVGKDRIGQVWEEVTGSGFEDVVIDEDGAAVFRVEAQKISVWVPK
KQ
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatggagtaatgatacaatattttgagtggaatttagctgatgatggaaaacat
tgggaaagactaaaaaatgatgccgctcatctaaaagaaattggagtttcagcagtttgg
attcctcctgcctataaagggactttttcaggagatgttggatacggtgcttatgatttg
tgggatttgggagagtttaatcaaaaaggaactgtgcgtacaaaatacggaacaaaagaa
gaactcattgatgcgattaatgaacttcataaatatggaataaatgtctatttggacgct
gtacttaatcataaaggaggtgctgacgaaacagaaagattttcggtaatagaggtggat
cctgaaaatagaaatgaagaaatttcagaaccaaaagagattgaaggatggacaaaattt
acttttcctggaagaaataagaagtattctgaatttgaatggaaccatactctttttagc
ggagttgactatgataatttgacaggaaaaaatgcaatttataaaattgttggagaaaat
aaaggatgggcagaaaatgtagattctgaacttggaaattatgactatcttatgaatgcc
gatgtggattattcacaccctgaagtgagaaatgaaattataaactggggaaaatgggtc
gtgaatgaattaaatctcgatggattcagaatggacgctgtaaaacatataagcggagat
tttatcaaagaatttttaattgaagtaagaaaagtttatggagaagaattttattctgtc
ggagaatattggaaagatgacttggatactttaaaaacttatttggaaaatataggatat
gaaactgatttatttgacgtgggacttcattttaattttcacaaagcttcggtggaaaaa
gaaaattatgatttgacaacaatactggataattcagtgatgcttatggatccaattaaa
gcggtaacatttgtggataatcacgattcgcaaaaaggaagtgctctggaatctgaaata
gaaagttggtttattccacacgcctatgcgataatattactttctgaaaaaggttaccca
tgcttattctacggagattattacggcgtaggaaacaataaaagtccgcacggatgggtg
atagataaacttctttatgtgagaagaaataatgcctatggagaacagataaattatttt
gatgatccaaatataatcgccttttacagaaaaggtagagaaaatgaaataaatacagga
tgcgtggctgttttgtccaataatgaagctggagaaaaagtaattgaagttggaaaagat
agaataggacaagtttgggaagaagttacaggaagtggatttgaagacgtggtaattgat
gaagatggagctgccgtatttcgtgttgaagcacaaaaaatttcagtttgggtaccgaaa
aaacaataa

DBGET integrated database retrieval system