KEGG   Legionella pneumophila 2300/99 Alcoy (serogroup 1): lpa_00657Help
Entry
lpa_00657         CDS       T01232                                 

Definition
(GenBank) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
lpa  Legionella pneumophila 2300/99 Alcoy (serogroup 1)
Pathway
lpa00500  Starch and sucrose metabolism
lpa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    lpa_00657
Enzymes [BR:lpa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     lpa_00657
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15 Complex1_LYR_2
Motif
Other DBs
NCBI-ProteinID: ADG23721
LinkDB All DBs
Position
complement(509502..510785)
Genome map
AA seq 427 aa AA seqDB search
MIFFVSQTMASVFTHEEVQILKKHFLNNFQTNGAIVASPSQYNPNYYYDWIRDSAIAMGL
VETWYEASQSARYKKLLLEYVSWTEKIQHQADPIAGQDILGEPKFYINGNPFDGEWGRPQ
NDGPALRASVLIRFAQQLLDHNEIDYVKSHLYNNTMDPQSMGTIKMDLEYIAHHWQDANF
DLWEEVYGHHFFTAMAQQKALTDGAILARQLHDRQAAVFYEMQANLINSRLQQHLDHQNK
IIQATLLPHPGPQKTLELDSSVMLGILTNPQKEGVFAPHHTFVRNTAKALHEQFNLMFPI
NKNRSGAILFGRYPGDTYDGYQTNSIGNPWFILTATMAEYYFTMAHNLSLNSSNKLHIQN
YLKKGDNYLRLIKQYGPDLNLSEQINLNTGVQQGATSLTWSYVSVLRAIHLREQLENRIK
TMGWNTY
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgattttttttgtctctcaaactatggcttcagtatttacccatgaagaggttcaaata
ttaaaaaaacattttttaaataactttcaaaccaatggagccatcgtagcctcaccctcg
caatacaatcccaattattattatgactggattcgagactctgccattgccatgggattg
gttgagacatggtatgaagccagccaatctgctcgatataaaaaacttttattagaatac
gtttcatggacagaaaaaatacagcatcaagcggatcccattgctggccaggatatattg
ggtgaacccaaattttatatcaatggcaatccttttgatggggaatggggacgaccacaa
aatgatggtccggcactcagagcatctgttttaattcgttttgcgcaacagcttctcgat
cataatgaaatagattatgtcaaatcacatctttataacaacaccatggacccacaatcc
atgggcactatcaagatggatttggaatacatcgcgcatcattggcaagatgcaaatttt
gacctgtgggaagaggtttatggccatcattttttcacggctatggcacaacaaaaagcg
ctgaccgatggcgccattttggctcgccaacttcatgacagacaagctgctgttttttat
gaaatgcaagccaacttaattaacagtcgactgcaacagcatttggaccatcagaataaa
ataattcaagccacattattacctcaccctggtcctcaaaaaacactagagcttgattcg
tccgtcatgttgggtattttaactaatccacaaaaagaaggtgtttttgccccacatcac
acctttgtgcgaaatactgcaaaggctttgcatgagcaatttaatttgatgtttcctatt
aataaaaaccgttctggagcaatattgtttggtcgttatcctggcgatacttatgatggc
tatcaaacaaacagcataggaaacccctggtttatcttaacagctacgatggctgaatat
tattttaccatggctcataatctgtccctgaacagcagtaataaacttcatatacagaac
tatctaaagaaaggggacaattacctaaggctgataaaacaatatggccctgatctgaat
ttaagtgaacaaattaatttgaataccggagttcagcaaggagcgacatccttgacctgg
agttacgtttccgtcttgcgagctattcatttaagagagcaattggaaaatagaataaaa
actatgggctggaatacctattag

DBGET integrated database retrieval system