KEGG   Legionella pneumophila 2300/99 Alcoy (serogroup 1): lpa_02076Help
Entry
lpa_02076         CDS       T01232                                 

Gene name
glpA
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
lpa  Legionella pneumophila 2300/99 Alcoy (serogroup 1)
Pathway
lpa00564  Glycerophospholipid metabolism
lpa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lpa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    lpa_02076 (glpA)
Enzymes [BR:lpa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     lpa_02076 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored NAD_binding_8 GIDA HI0933_like Pyr_redox_2 3HCDH_N Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ADG24741
LinkDB All DBs
Position
complement(1622201..1623721)
Genome map
AA seq 506 aa AA seqDB search
MDQVFDVAIIGGGINGCGCAADAALRGLSVILFEQDDLASKTSSSSTKLIHGGLRYLEHY
EFGLVKKALQERQTLLNLAPHLVHSQSFVLPYLKHMRPSWLLRLGLFFYDHLSRKNHLPK
SRSIHRNNKNNYFTPLKEELNRGFLFYDATTDDARLTILNAIQAKNHGASIRPHAKVTRA
EVINNIWHLTIQPTKGQSYKTYAKSIINATGPWVQSIAQLTHTPIQKDITLVKGSHIIVP
KLFEGNHAYFLQHNDQRVIFVIPYHGFSMIGTTDIHYTGDLNHIEIGEEEIDYLIELVNA
YFKFKITKEDVVHSWSGIRPLLADDSKEVKSLSRDYSYEFNHSPAPIITIFGGKITTYRQ
LAEEVVDQLTPVFPQMKPSKTQHTPLPGATLADMSFTQYVNYAKTKYHWLDDELLNRYLN
TYGCYTEIFLSQCNNMEAMGKKYGPSLYQVEVDYLILEEWANYCDDILNRRTKLGLTMDN
ASKKELADYLASISTYPSAQAELVFH
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggatcaggtttttgatgttgcaattattggtggaggcatcaatggctgcggctgcgct
gcagatgcagcattaagaggtctgtctgtgatactcttcgaacaggacgatctggcttcg
aaaacctcatcaagtagcacaaaattaattcatggtggtttaaggtatttagagcattat
gaatttggtttagtcaaaaaagcactccaggaacgtcaaacgcttctcaatttggctccc
catttagtccattcccaatcttttgttttgccctacttaaaacatatgcgcccctcatgg
ttattgaggttaggtttatttttttacgatcatctcagtcgaaaaaatcatttacccaaa
tccagatcgatccacagaaataataagaataattattttacgccactaaaagaggagcta
aatcgcggttttcttttctatgatgccaccacggatgatgctcgcttaaccattcttaac
gccatacaagccaaaaatcatggcgcaagcataaggccacatgccaaagtaacccgtgct
gaggtaatcaataacatatggcatttaactatccagcccaccaaagggcagagctataaa
acttatgctaaaagcatcattaatgccacaggaccatgggtgcaatccattgcccaatta
actcatacacctatccaaaaagatattaccctggttaaaggtagccatattatcgtcccc
aaactttttgagggaaatcatgcctatttcttgcaacataatgatcagcgggttattttt
gttatcccctatcatggctttagtatgattggaaccacagatatccactatactggggat
cttaaccacatagagattggtgaagaagaaattgattacttaattgaattggtaaatgcc
tacttcaagtttaaaataactaaagaagatgtagtccattcctggagcggcataaggcct
ttattagctgatgatagcaaggaagtcaaatcattaagtcgtgactattcctatgagttt
aaccactccccagctcctattattacaatttttggaggaaaaataaccacttacagacag
ttggctgaagaagttgtagatcaacttacccctgtatttccacaaatgaagccatcgaaa
acacaacacacgcccttaccgggggcaactttagcggatatgagttttactcaatatgtc
aattacgccaaaacaaaatatcattggctggatgatgaactattaaatcgctacctcaat
acctatggttgttatactgaaatttttctttcgcaatgcaacaatatggaagcaatgggg
aaaaaatatggcccatcactctaccaggtggaagtagattatcttattttagaagagtgg
gcaaattattgtgatgacatacttaaccgccgcactaagctcggccttactatggataat
gccagtaaaaaagaacttgcggattatctggctagtatatctacttatccttctgctcaa
gctgagctcgtatttcactaa

DBGET integrated database retrieval system