KEGG   Lactobacillus paracasei subsp. paracasei JCM 8130: LBPC_0085Help
Entry
LBPC_0085         CDS       T04768                                 

Definition
(GenBank) aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Organism
lpap  Lactobacillus paracasei subsp. paracasei JCM 8130
Pathway
lpap00260  Glycine, serine and threonine metabolism
lpap00261  Monobactam biosynthesis
lpap00270  Cysteine and methionine metabolism
lpap00300  Lysine biosynthesis
lpap01100  Metabolic pathways
lpap01110  Biosynthesis of secondary metabolites
lpap01120  Microbial metabolism in diverse environments
lpap01130  Biosynthesis of antibiotics
lpap01210  2-Oxocarboxylic acid metabolism
lpap01230  Biosynthesis of amino acids
Module
lpap_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
lpap_M00525  Lysine biosynthesis, acetyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:lpap00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LBPC_0085
   00270 Cysteine and methionine metabolism
    LBPC_0085
   00300 Lysine biosynthesis
    LBPC_0085
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    LBPC_0085
Enzymes [BR:lpap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     LBPC_0085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase ACT_7 Fumble
Motif
Other DBs
NCBI-ProteinID: BAN70381
LinkDB All DBs
Position
89374..90753
Genome map
AA seq 459 aa AA seqDB search
MRVVKFGGSSLANGSQFAKVVAIMKANPARQVIVTSAPGKRHPGDTKVTDLLIQYAQAVM
RHEAVAAIVAEIVARYQAIADDFELEASIMATIEEELDQLPKLTFKNNDYLMAGFKARGE
KLNAFLMTAVLNHEGIEATYGEPKSLGIVVTDHPNDAEVSRETYRNLATFRRPIGVLVVP
GFYGYTSDDDIATFSRGGSDITGAILANGFHADLYENFTDVDGVAAADPRVVANPQMIRE
MTYREMRELSYGGFGVFHDEAILPAIAGQVPINLKNTNHPAAPGTMIVPEQHFVPKHAIT
GIVSSQHFGAIYLHRYLLNKEVGFTLKILQVLAHNGISYEHMPSGIDDLTIILDDRQLTE
AKRKTICAEIQAAVHPDVLKWIDDYAIIMVVGEGMAQRIGLIQTILQPLATAGVHVSMIN
EGASQISLMLGTSRESANRAVKTIYNAFFIPINQRLEVH
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgtcgtaaaatttggcggttcatcgctagcaaatggttcacaattcgccaaggtc
gtggcgatcatgaaggctaacccagctcggcaggtgatcgtgacgagtgcgccaggtaaa
cggcacccgggagacaccaaggtgaccgatttattgattcagtatgcacaggcagtgatg
cggcatgaagctgtggctgccattgttgcagaaatcgttgctcgatatcaggcaatcgcc
gatgattttgagctcgaagcatcgatcatggccacgattgaagaagagctagaccagtta
ccaaagttgactttcaagaacaatgattatttaatggcaggctttaaggcgcgcggtgaa
aagttgaacgcgtttttaatgaccgcggtgttgaatcatgaggggattgaagctacctat
ggcgaaccgaagtcgttaggaattgtggtcacagatcatcccaatgatgccgaagtttca
cgtgaaacctatcgcaacctcgctacatttcgacgaccaatcggggttttggttgtaccg
ggattttatggctataccagcgatgacgatattgccaccttttctcgtggtggctccgat
atcacgggagcgattttggctaacggttttcatgccgatttatatgaaaactttaccgat
gtcgatggcgtagcggctgctgacccacgggtggtggcgaatccgcaaatgattcgtgaa
atgacctatcgggaaatgcgagagctgtcttatggcggctttggtgtttttcatgatgaa
gcaattctgccagcgattgctgggcaggtaccgattaatcttaaaaataccaatcatcct
gctgctccagggacaatgatcgtcccagaacagcattttgtcccgaagcatgccattacc
gggattgtaagttcccaacattttggggcgatctacctgcatcgatatctgttgaataag
gaagttggcttcactctgaagattcttcaggtgttagcccacaacggcattagttatgag
cacatgcccagcggaattgatgatctaaccattattttagatgatcgccagctaactgag
gccaaacgcaagacaatttgtgccgagattcaagcggcggttcatccagatgtgctgaag
tggattgatgactatgcgatcatcatggtcgttggtgaagggatggcgcaacgaatcgga
ttgattcaaaccattctacaaccgctcgcaaccgccggcgttcatgtctcaatgattaat
gagggggcctctcagatttctctgatgctgggaacctcacgtgagtcggccaatcgcgct
gttaaaacgatctacaatgctttttttataccgattaatcaacgtttggaggtgcactaa

DBGET integrated database retrieval system