KEGG   Lactobacillus paracasei subsp. paracasei JCM 8130: LBPC_0129Help
Entry
LBPC_0129         CDS       T04768                                 

Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lpap  Lactobacillus paracasei subsp. paracasei JCM 8130
Pathway
lpap00473  D-Alanine metabolism
lpap00550  Peptidoglycan biosynthesis
lpap01100  Metabolic pathways
lpap01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lpap00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LBPC_0129
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LBPC_0129
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    LBPC_0129
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lpap01011]
    LBPC_0129
Enzymes [BR:lpap01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     LBPC_0129
Peptidoglycan biosynthesis and degradation proteins [BR:lpap01011]
 Precursor biosynthesis
  Amino acid ligase
   LBPC_0129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp_3 RimK CPSase_L_D2 ATP-grasp GARS_A
Motif
Other DBs
NCBI-ProteinID: BAN70425
LinkDB All DBs
Position
complement(138062..139135)
Genome map
AA seq 357 aa AA seqDB search
MKIVVLAGGRSTERNVSISSGYRITNALRQKGQQATFIDLFLGYDLEGKTVEQVFDDANT
SKDLNISDAILTDEDINKLRPDGSTQLFGPNVMAICKAADIVFLALHGGDGENGKVQAVF
DINGVKYTGSGPLASGITMNKVFSKEVMLYHGIQTSGFKEFKRDQGPKQTVPFDFPVVVK
PTSGGSSVGTHIIHNQEELESGLEDVFRFDNSAIVEEFTPGREFSLGVVNGHAYSAIEIK
VRSGWYDFKHKFQAGYTDFITPPKDLDEDVHQAMKDVAVQTMDVLGLQNYGRIDFFANEK
GVWVIEANNLPGMTPLSLLPQEAEADGVDYGDLVMDIVNGKLKLYADGMTEAGLLTK
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgtcgttttagcaggcggccggagcacggagcgcaatgtttccatttctagc
ggctaccggatcacgaacgccttgcggcaaaaagggcagcaggccacctttattgacctg
tttcttggctacgacctcgaagggaagacggtcgagcaggtttttgacgacgccaacacc
agcaaggatctgaatatttcagatgcgattctgactgatgaagacatcaataagttacga
ccagatggcagcacccagctatttggtcccaatgttatggcgatctgcaaagcagcggac
attgttttcctcgctttgcatggtggcgatggcgaaaacggtaaggttcaggctgtgttt
gacatcaacggggtcaagtatactggctctggcccgctggcttcaggcatcaccatgaac
aaggttttcagtaaggaagtcatgttgtatcatggcattcagacttcaggattcaaggaa
ttcaagcgcgatcaagggccaaaacaaacggtcccgtttgattttccagttgttgtcaag
ccaacatccggcggttccagcgttgggacacatattattcataatcaggaagaactcgaa
agtggtcttgaagatgttttccgcttcgacaacagcgccattgttgaagagttcacccca
ggtcgcgaattctcgttaggcgttgtcaatggccacgcttactcggccattgaaattaag
gtgcgttctggttggtatgatttcaagcataaattccaagccggctataccgacttcatc
accccgccaaaggatctcgatgaagatgtccatcaggctatgaaagatgttgccgtccaa
acgatggatgttctgggcctacaaaattacggccgaatcgacttcttcgccaacgaaaaa
ggtgtttgggtcattgaagccaacaacctgccggggatgacaccactgtcactgttgccg
caagaagccgaagcagacggtgttgactacggcgatttggtgatggatattgtcaacggc
aagctcaagctctacgctgacggcatgaccgaggctggactcttaacgaagtaa

DBGET integrated database retrieval system