KEGG   Lactobacillus paracasei subsp. paracasei JCM 8130: LBPC_0995Help
Entry
LBPC_0995         CDS       T04768                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
lpap  Lactobacillus paracasei subsp. paracasei JCM 8130
Pathway
lpap00970  Aminoacyl-tRNA biosynthesis
lpap01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpap00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LBPC_0995
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lpap03029]
    LBPC_0995
Enzymes [BR:lpap01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     LBPC_0995
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     LBPC_0995
Mitochondrial biogenesis [BR:lpap03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    LBPC_0995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: BAN71291
LinkDB All DBs
Position
1056299..1057729
Genome map
AA seq 476 aa AA seqDB search
MNFETTIGLEVHVELKTKSKMFSPSPVTYGQEPNTQTNVIDWGFPGVLPSINRGAYQLGI
MVGLALHADITRLTHFDRKNYFYPDNPKAYQITQSEKPLGTNGWVEIEVDGKKKKIGIAE
LHVEEDAGKNQHEDDGYSYVDLNRQGTPLVEIVSKPDITSPEEAYAYLETLRQIVQFTGA
SDVKMEEGSMRVDTNLSVRPIGQEHFGTKTEIKNLNSFVHVRDGLAFEEKRQQAVLLSGG
EVRQETRRWDPDAKETLLMRVKEGADDYRYFPEPDLPPVAVSQKWIDDIQASLPQPPAER
RQRYIEDWGIPAYDAGVLTQTKEMSDFFEATVAQGADAKQASNWLMGEVSGFLNAQHVEL
GQVALTPAHLAGMIKLIGDGTISSKMAKKVFKEIIQHDTDPDKWVHEKGLIQLSDPAKLT
PIIDEILDNNQQSIDDFKAGKDRAIGFLVGQIMKQTHGQANPKVVNQILMAEIKQR
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaactttgaaacaacaatcgggcttgaagtccacgttgagttgaaaaccaaatcgaaa
atgttctcaccatcacctgtcacttatggtcaggaacccaacacccagacaaacgtgatt
gactggggattcccaggcgttttgccgagcatcaatcgcggagcctatcaacttggcatc
atggtggggctggcattgcatgctgacatcacgcgtttgactcattttgatcggaaaaac
tatttctatcctgacaaccctaaagcttatcaaatcacccaaagtgagaagcctttgggc
accaatggctgggtggaaattgaagttgacggtaagaagaagaagattggtatcgcagaa
ctgcatgttgaagaagatgccgggaagaaccagcacgaagacgatggttattcctatgtt
gatttgaaccgtcaaggcacaccgctggtcgaaattgtttccaaaccggatatcaccagt
ccagaagaagcttatgcttatctggaaaccttgcgccaaatcgttcagttcacaggggct
tcggacgttaagatggaagaaggctctatgcgggttgataccaatttgtcagtgcgacca
attggacaggaacattttggtaccaagaccgaaatcaagaacctgaactccttcgtgcat
gttcgcgatggcctcgcatttgaagaaaaacggcagcaggctgtacttttgagtggcggt
gaagtgcgtcaggaaacccggcgctgggatccagatgctaaagaaacgcttctgatgcgg
gttaaggaaggcgccgatgattatcgttacttccctgaaccagacctgccaccagtggct
gtttcccagaaatggattgacgacattcaggcctcgttaccgcaaccgccagcagagcgg
cggcagcgttacatcgaagactggggaatcccagcttatgatgccggtgtcttgacgcag
acgaaggaaatgtcagatttcttcgaagcaactgtggcgcaaggcgctgatgccaagcaa
gcgtctaactggctgatgggtgaggtttccggtttcttgaatgcccaacacgttgaactg
gggcaagttgccttgacgccagcgcatttggcaggcatgatcaagcttattggtgatggc
acgatttccagtaaaatggccaaaaaggtctttaaggaaatcattcaacatgatactgat
ccggataagtgggtccatgaaaaaggtctgatccaactttccgatccggctaaattgacc
ccgattattgacgaaattctcgataataaccagcaaagtatcgatgacttcaaagctggt
aaggaccgggcaattggcttcctagttggtcagatcatgaaacaaacacatggtcaggca
aaccctaaagtggtcaaccagattttgatggctgagattaagcaacgataa

DBGET integrated database retrieval system