KEGG   Lactobacillus parabuchneri: FAM21731_00072Help
Entry
FAM21731_00072    CDS       T04617                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
lpar  Lactobacillus parabuchneri
Pathway
lpar00620  Pyruvate metabolism
lpar00680  Methane metabolism
lpar01100  Metabolic pathways
lpar01120  Microbial metabolism in diverse environments
lpar01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lpar00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    FAM21731_00072
  Energy metabolism
   00680 Methane metabolism
    FAM21731_00072
Enzymes [BR:lpar01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     FAM21731_00072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2 PEPcase
Motif
Other DBs
NCBI-ProteinID: APR06339
UniProt: A0A1X1FI81
LinkDB All DBs
Position
58370..59878
Genome map
AA seq 502 aa AA seqDB search
MDRKIPNIMGTQHPDNAGVPFFKHNDSAFVSAFREIDEAYQNFSKLGADEYMWDWEGKHA
DASVIDRLYSEHYEYFQKHPLGKDKFLTFRLPNIWEEKGYSLMQAMTTILSAEDFSYDLG
FKERPLFEAILPMTQSADQLISMEDKFASLSHYKSTEFNTGHKDSDTLQMIPLFEGFESQ
LNAPQILKKYLEMYKEHFGRELSYMRVFLAGSDSALSNGFLNSIIGNKLALTGLAEFEQE
SGLPIYPIAGMGSTIFRGGLSPMMIDRYLEEFPGLKTATVQSAFRYDYPLDVVEPAIIKL
RDGLQQSKFEIINHDDQDILLNIAKKAAAEYHETLDPLINDLQPVFDSFPKRRDRHQHVG
IIGYSRDVDGYKMPRAITFTGALYSVGVPPEFLGTGRILNKLDDKELSTLMKYYPNIKHD
YAHVAKYFSKDALAALQAKNPAWKAVDEDIEAVERLFDIKAGPQTPEQEKHAQLAADLVK
ISDKETKTTLISRQAILRKFLG
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggatagaaaaatccctaacattatgggtactcaacatccagataacgcaggagttccc
ttcttcaagcataacgatagcgcatttgtttccgcatttcgggaaattgatgaagcctac
caaaacttctcaaagctcggcgctgacgaatacatgtgggactgggaaggtaaacacgcc
gatgcgtcagtgatcgaccgtttatactctgagcactacgagtatttccaaaagcatccc
cttggcaaggataagtttttaactttccgtctgccaaacatctgggaagaaaaaggctac
agcttaatgcaagccatgacaaccatcttgtcagccgaagacttctcttacgacttgggc
tttaaggaacgaccgttattcgaagcaatcttgccgatgacacaatcagccgaccagctg
atttcaatggaagacaagtttgccagcctttctcactacaaatcaactgaatttaatacc
ggccacaaagattccgataccttgcaaatgattccactgtttgaaggctttgaatcacaa
ttaaatgcgccgcaaattttgaagaaataccttgaaatgtataaagaacattttggccgc
gaacttagctacatgcgggtattcttagccggatcagactccgctttgtcaaatggtttc
ttgaacagtatcattggaaataaattagcgttgactggtctcgccgaatttgaacaggaa
agcggcttgccaatttatccaattgccggaatgggaagcacgattttccgtggcggcttg
tctccaatgatgatcgaccgttatctcgaagaattccctggcttaaagaccgcaaccgta
cagtctgccttccgttacgactacccgttagacgtggttgaaccggccatcatcaaatta
cgtgacggtttgcaacaaagtaagtttgaaatcatcaaccatgatgaccaagatatcctg
ttgaatatcgccaagaaggctgccgcagaataccacgaaactttggatccgttaatcaat
gacttacaacctgtctttgattccttcccaaagcgtcgtgaccgtcaccaacacgtcggg
atcatcggttattcccgtgacgttgacggctacaagatgccgcgtgcgatcacctttacc
ggcgccctttattcagttggtgttccacctgaattcttgggaaccggccgtatcttgaac
aagttggatgataaagaactcagcactttgatgaagtattatccaaatatcaagcatgat
tacgcccacgttgccaaatacttcagtaaggacgctttggctgcccttcaagcaaagaac
cccgcttggaaagcagttgacgaagatatcgaagccgttgaacgcttatttgatatcaag
gctggtccacaaacacctgaacaggaaaagcacgcccaattggcagctgatttagttaag
atttctgacaaggaaaccaagacgacattgatcagccgtcaagctattttacgaaaattc
ctaggttaa

DBGET integrated database retrieval system